mRNA_L-elsbetiae_contig7901.16858.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig7901.16858.1 vs. uniprot
Match: A0A6H5L6K9_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L6K9_9PHAE) HSP 1 Score: 58.9 bits (141), Expect = 1.120e-6 Identity = 25/27 (92.59%), Postives = 27/27 (100.00%), Query Frame = 3 Query: 3 HGDPSSWSNFLRSSGLVERETLNHVAR 83 HGDP+SWS+FLRSSGLVERETLNHVAR Sbjct: 36 HGDPTSWSSFLRSSGLVERETLNHVAR 62
BLAST of mRNA_L-elsbetiae_contig7901.16858.1 vs. uniprot
Match: D7FVY3_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FVY3_ECTSI) HSP 1 Score: 57.0 bits (136), Expect = 5.040e-6 Identity = 24/26 (92.31%), Postives = 26/26 (100.00%), Query Frame = 3 Query: 3 HGDPSSWSNFLRSSGLVERETLNHVA 80 HGDP+SWS+FLRSSGLVERETLNHVA Sbjct: 36 HGDPASWSSFLRSSGLVERETLNHVA 61 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig7901.16858.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig7901.16858.1 >prot_L-elsbetiae_contig7901.16858.1 ID=prot_L-elsbetiae_contig7901.16858.1|Name=mRNA_L-elsbetiae_contig7901.16858.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=122bp MSTTTTTTTTRNKSNNVVQMIVEFPEVASSRELVGQYSRVPRLHGGSVGSback to top mRNA from alignment at L-elsbetiae_contig7901:4445..5051+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig7901.16858.1 ID=mRNA_L-elsbetiae_contig7901.16858.1|Name=mRNA_L-elsbetiae_contig7901.16858.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=607bp|location=Sequence derived from alignment at L-elsbetiae_contig7901:4445..5051+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig7901:4445..5051+ >mRNA_L-elsbetiae_contig7901.16858.1 ID=mRNA_L-elsbetiae_contig7901.16858.1|Name=mRNA_L-elsbetiae_contig7901.16858.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=732bp|location=Sequence derived from alignment at L-elsbetiae_contig7901:4445..5051+ (Laminarionema elsbetiae ELsaHSoW15)back to top |