mRNA_L-elsbetiae_contig7419.16299.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig7419.16299.1 vs. uniprot
Match: D7G4X8_ECTSI (EsV-1-7 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G4X8_ECTSI) HSP 1 Score: 60.8 bits (146), Expect = 5.210e-8 Identity = 32/77 (41.56%), Postives = 50/77 (64.94%), Query Frame = 2 Query: 32 TCTHHGCSKQPTYGKAGGKAEYCSDHSKDGTVDVVSKLCAFSGCTVRASLGEEATTTVIRKLCARHAEEGMDRISGR 262 +CT +GC+++PT+G AG KAE+C+ HS +V+V S+ C+ GC+ RA G + R+ ++HA EGM +S R Sbjct: 49 SCTLYGCTRKPTHGVAGKKAEFCARHSLATSVNV-SQECSIDGCSTRAHYGVAGSKK--REFXSKHALEGMVNLSNR 122
BLAST of mRNA_L-elsbetiae_contig7419.16299.1 vs. uniprot
Match: D7FR73_ECTSI (EsV-1-7 (Partial) (Fragment) n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FR73_ECTSI) HSP 1 Score: 57.0 bits (136), Expect = 5.640e-7 Identity = 30/60 (50.00%), Postives = 38/60 (63.33%), Query Frame = 2 Query: 5 GMVNVKSKKTCTHHGCSKQPTYGKAG----GKAEYCSDHSKDGTVDVVSKLCAFSGCTVR 172 GMV+V S +TC GC K+ T+G G A +C H+++G DVVSK CAF GCTVR Sbjct: 3 GMVDV-SIRTCAQEGCPKRATHGTPGMDDSKTAPFCMSHAREGMEDVVSKRCAFQGCTVR 61 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig7419.16299.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig7419.16299.1 >prot_L-elsbetiae_contig7419.16299.1 ID=prot_L-elsbetiae_contig7419.16299.1|Name=mRNA_L-elsbetiae_contig7419.16299.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=144bp MVNVKSKKTCTHHGCSKQPTYGKAGGKAEYCSDHSKDGTVDVVSKLCAFSback to top mRNA from alignment at L-elsbetiae_contig7419:4216..4654+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig7419.16299.1 ID=mRNA_L-elsbetiae_contig7419.16299.1|Name=mRNA_L-elsbetiae_contig7419.16299.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=439bp|location=Sequence derived from alignment at L-elsbetiae_contig7419:4216..4654+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig7419:4216..4654+ >mRNA_L-elsbetiae_contig7419.16299.1 ID=mRNA_L-elsbetiae_contig7419.16299.1|Name=mRNA_L-elsbetiae_contig7419.16299.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=864bp|location=Sequence derived from alignment at L-elsbetiae_contig7419:4216..4654+ (Laminarionema elsbetiae ELsaHSoW15)back to top |