mRNA_L-elsbetiae_contig7411.16296.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig7411.16296.1 vs. uniprot
Match: A0A6H5JYR3_9PHAE (WSC domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JYR3_9PHAE) HSP 1 Score: 68.2 bits (165), Expect = 3.480e-10 Identity = 43/89 (48.31%), Postives = 50/89 (56.18%), Query Frame = 1 Query: 1 KCRDNCS--GYQYFGLESGVKCFCSNE---SPP----GEPIENCG----FPDDEWVWEYRWLCSGESRVQCGTRLAISVYEITDETGDG 228 KC C+ G +YFGLES VKC C +E SP GE CG F D V EY++LCSG+SRV CGT ISVY + TG G Sbjct: 132 KCAATCTAQGTRYFGLESAVKCLCGDELAGSPTDDVYGEGGSVCGIDITFGGD--VPEYKYLCSGDSRVLCGTDDHISVYSLDGSTGGG 218
BLAST of mRNA_L-elsbetiae_contig7411.16296.1 vs. uniprot
Match: A0A6H5K6V8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K6V8_9PHAE) HSP 1 Score: 68.6 bits (166), Expect = 5.490e-10 Identity = 42/90 (46.67%), Postives = 50/90 (55.56%), Query Frame = 1 Query: 1 KCRDNCS--GYQYFGLESGVKCFCSNESPPGEPIEN--------CG----FPDDEWVWEYRWLCSGESRVQCGTRLAISVYEITDETGDG 228 KC C+ G QYFGLES VKC C +E G P ++ CG F D V EY++LCSG+SRV CGT ISVY + TG G Sbjct: 254 KCAATCTAQGTQYFGLESAVKCLCGDELV-GSPTDDVYGDGGSVCGIDITFGGD--VPEYKYLCSGDSRVLCGTDDHISVYSLDGSTGGG 340
BLAST of mRNA_L-elsbetiae_contig7411.16296.1 vs. uniprot
Match: A0A6H5K384_9PHAE (WSC domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K384_9PHAE) HSP 1 Score: 68.6 bits (166), Expect = 5.800e-10 Identity = 42/90 (46.67%), Postives = 50/90 (55.56%), Query Frame = 1 Query: 1 KCRDNCS--GYQYFGLESGVKCFCSNESPPGEPIEN--------CG----FPDDEWVWEYRWLCSGESRVQCGTRLAISVYEITDETGDG 228 KC C+ G QYFGLES VKC C +E G P ++ CG F D V EY++LCSG+SRV CGT ISVY + TG G Sbjct: 194 KCAATCTAQGTQYFGLESAVKCLCGDELV-GSPTDDVYGDGGSVCGIDITFGGD--VPEYKYLCSGDSRVLCGTDDHISVYSLDGSTGGG 280
BLAST of mRNA_L-elsbetiae_contig7411.16296.1 vs. uniprot
Match: A0A6H5K566_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K566_9PHAE) HSP 1 Score: 68.6 bits (166), Expect = 6.380e-10 Identity = 42/90 (46.67%), Postives = 50/90 (55.56%), Query Frame = 1 Query: 1 KCRDNCS--GYQYFGLESGVKCFCSNESPPGEPIEN--------CG----FPDDEWVWEYRWLCSGESRVQCGTRLAISVYEITDETGDG 228 KC C+ G QYFGLES VKC C +E G P ++ CG F D V EY++LCSG+SRV CGT ISVY + TG G Sbjct: 254 KCAATCTAQGTQYFGLESAVKCLCGDELV-GSPTDDVYGDGGSVCGIDITFGGD--VPEYKYLCSGDSRVLCGTDDHISVYSLDGSTGGG 340
BLAST of mRNA_L-elsbetiae_contig7411.16296.1 vs. uniprot
Match: D7FMV1_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FMV1_ECTSI) HSP 1 Score: 66.2 bits (160), Expect = 3.920e-9 Identity = 36/80 (45.00%), Postives = 46/80 (57.50%), Query Frame = 1 Query: 1 KCRDNCS--GYQYFGLESGVKCFCSNE---SP----PGEPIENCGFPDDEWVWEYRWLCSGESRVQCGTRLAISVYEITD 213 KC C+ G YFGLES VKC C +E SP GE + + DD + EY++LCSGES V CGT +SVY + + Sbjct: 268 KCAAICTEQGTAYFGLESAVKCLCGDELDGSPYDDVRGESVCGVDYTDDVNIPEYKFLCSGESTVLCGTDTHMSVYSLNE 347 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig7411.16296.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 5
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig7411.16296.1 >prot_L-elsbetiae_contig7411.16296.1 ID=prot_L-elsbetiae_contig7411.16296.1|Name=mRNA_L-elsbetiae_contig7411.16296.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=161bp KCRDNCSGYQYFGLESGVKCFCSNESPPGEPIENCGFPDDEWVWEYRWLCback to top mRNA from alignment at L-elsbetiae_contig7411:8082..9851- Legend: polypeptideCDSUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig7411.16296.1 ID=mRNA_L-elsbetiae_contig7411.16296.1|Name=mRNA_L-elsbetiae_contig7411.16296.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=1770bp|location=Sequence derived from alignment at L-elsbetiae_contig7411:8082..9851- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig7411:8082..9851- >mRNA_L-elsbetiae_contig7411.16296.1 ID=mRNA_L-elsbetiae_contig7411.16296.1|Name=mRNA_L-elsbetiae_contig7411.16296.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=966bp|location=Sequence derived from alignment at L-elsbetiae_contig7411:8082..9851- (Laminarionema elsbetiae ELsaHSoW15)back to top |