mRNA_L-elsbetiae_contig6.14514.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig6.14514.1 vs. uniprot
Match: A0A6C1PPK0_9SPIO (Glyco_hydro_20b domain-containing protein n=1 Tax=Spirochaetaceae bacterium TaxID=1898206 RepID=A0A6C1PPK0_9SPIO) HSP 1 Score: 55.1 bits (131), Expect = 2.800e-6 Identity = 28/88 (31.82%), Postives = 46/88 (52.27%), Query Frame = 1 Query: 4 VRVAGTGEPGLYYGVRTLCQLLRFYARPSRAGESALGIPCCILRDEPDVVRRSLVLDVRYPLVPTWSSLMRTIEAASHSRVNVVQLTV 267 + +A + G YY +TL L+ + R +PC ++RDEPD+VRR LD VPT ++ + +E + ++N +QL V Sbjct: 84 IEIASSTAVGAYYATQTLRDLIAMHGR---------SLPCVVIRDEPDLVRRGFYLDCSRGKVPTVETVRQLVERLARWKINELQLYV 162
BLAST of mRNA_L-elsbetiae_contig6.14514.1 vs. uniprot
Match: R6GXA7_9FIRM (Beta-N-acetylhexosaminidase n=1 Tax=Firmicutes bacterium CAG:137 TaxID=1263004 RepID=R6GXA7_9FIRM) HSP 1 Score: 53.5 bits (127), Expect = 9.680e-6 Identity = 31/88 (35.23%), Postives = 45/88 (51.14%), Query Frame = 1 Query: 4 VRVAGTGEPGLYYGVRTLCQLLRFYARPSRAGESALGIPCCILRDEPDVVRRSLVLDVRYPLVPTWSSLMRTIEAASHSRVNVVQLTV 267 VR+ G+GE GL YGV+TL Q+LR + L +PC L D P + R L DV +PT + L + S ++N + L + Sbjct: 91 VRITGSGEAGLLYGVQTLRQILR---------QEGLVLPCLHLTDRPALATRGLFYDVTRGRIPTMAFLKDLADRCSFYKLNQLHLYI 169
BLAST of mRNA_L-elsbetiae_contig6.14514.1 vs. uniprot
Match: A0A7X7AYV4_9BACT (Beta-N-acetylhexosaminidase n=1 Tax=Armatimonadetes bacterium TaxID=2033014 RepID=A0A7X7AYV4_9BACT) HSP 1 Score: 52.0 bits (123), Expect = 3.500e-5 Identity = 29/81 (35.80%), Postives = 42/81 (51.85%), Query Frame = 1 Query: 10 VAGTGEPGLYYGVRTLCQLLRFYARPSRAGESALGIPCCILRDEPDVVRRSLVLDVRYPLVPTWSSLMRTIEAASHSRVNV 252 V+G G GL+YGV+TLCQL+R A GIPC +RD P + R D+ T + L R + +H ++N+ Sbjct: 126 VSGAGPAGLFYGVQTLCQLIR-------ANRQGQGIPCLAIRDWPSLRWRCFQDDLTRGPSSTLAELKRQADLGAHLKLNL 199
BLAST of mRNA_L-elsbetiae_contig6.14514.1 vs. uniprot
Match: A0A2E8K5V2_9GAMM (Beta-N-acetylhexosaminidase n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2E8K5V2_9GAMM) HSP 1 Score: 51.2 bits (121), Expect = 6.180e-5 Identity = 29/79 (36.71%), Postives = 46/79 (58.23%), Query Frame = 1 Query: 25 EPGLYYGVRTLCQLLRFYARPSRAGESALGIPCCILRDEPDVVRRSLVLDVRYPLVPTWSSLMRTIEAASHSRVNVVQL 261 EPG+YYG+ TL Q+L +AG SA +++DEPD R ++LD+ VP+ +L R I+ + ++N +QL Sbjct: 96 EPGIYYGLTTLNQILE------QAGTSASHF---LVQDEPDFATRGVMLDISRCKVPSMKTLYRLIDQLAQMKINQLQL 165
BLAST of mRNA_L-elsbetiae_contig6.14514.1 vs. uniprot
Match: A0A1M6UXJ0_9FIRM (Beta-N-acetylhexosaminidase n=1 Tax=Anaerocolumna jejuensis DSM 15929 TaxID=1121322 RepID=A0A1M6UXJ0_9FIRM) HSP 1 Score: 51.2 bits (121), Expect = 6.180e-5 Identity = 30/88 (34.09%), Postives = 50/88 (56.82%), Query Frame = 1 Query: 4 VRVAGTGEPGLYYGVRTLCQLLRFYARPSRAGESALGIPCCILRDEPDVVRRSLVLDVRYPLVPTWSSLMRTIEAASHSRVNVVQLTV 267 +++A E GL YG++TL Q++ S+AG AL +PCC ++D P++ R DV +PT SL + S+ ++N +QL + Sbjct: 88 IQLAAGSERGLLYGIQTLRQMV------SQAG--AL-LPCCEIKDYPEIANRGYYFDVTRGRIPTMESLKALADKLSYYKMNQLQLYI 166 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig6.14514.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 5
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig6.14514.1 >prot_L-elsbetiae_contig6.14514.1 ID=prot_L-elsbetiae_contig6.14514.1|Name=mRNA_L-elsbetiae_contig6.14514.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=124bp MVRVAGTGEPGLYYGVRTLCQLLRFYARPSRAGESALGIPCCILRDEPDVback to top mRNA from alignment at L-elsbetiae_contig6:82662..83690+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig6.14514.1 ID=mRNA_L-elsbetiae_contig6.14514.1|Name=mRNA_L-elsbetiae_contig6.14514.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=1029bp|location=Sequence derived from alignment at L-elsbetiae_contig6:82662..83690+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig6:82662..83690+ >mRNA_L-elsbetiae_contig6.14514.1 ID=mRNA_L-elsbetiae_contig6.14514.1|Name=mRNA_L-elsbetiae_contig6.14514.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=744bp|location=Sequence derived from alignment at L-elsbetiae_contig6:82662..83690+ (Laminarionema elsbetiae ELsaHSoW15)back to top |