mRNA_L-elsbetiae_contig5866.14330.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig5866.14330.1 vs. uniprot
Match: A0A6H5K6V8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K6V8_9PHAE) HSP 1 Score: 86.7 bits (213), Expect = 4.370e-18 Identity = 38/58 (65.52%), Postives = 44/58 (75.86%), Query Frame = 1 Query: 82 VLDTLNTPLMDDP-SYAPTPPGGGESATYRWPLEGTEGYYSLMYSGPMPPLQCPNLHP 252 + DTLNTP DD YAP P G GE T+ +PLEG+EGYYS+MYSGP PPL+C NLHP Sbjct: 143 IWDTLNTPFFDDSLDYAPIPSGSGEEETFTFPLEGSEGYYSVMYSGPFPPLECSNLHP 200
BLAST of mRNA_L-elsbetiae_contig5866.14330.1 vs. uniprot
Match: A0A6H5K384_9PHAE (WSC domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K384_9PHAE) HSP 1 Score: 86.7 bits (213), Expect = 4.980e-18 Identity = 38/58 (65.52%), Postives = 44/58 (75.86%), Query Frame = 1 Query: 82 VLDTLNTPLMDDP-SYAPTPPGGGESATYRWPLEGTEGYYSLMYSGPMPPLQCPNLHP 252 + DTLNTP DD YAP P G GE T+ +PLEG+EGYYS+MYSGP PPL+C NLHP Sbjct: 83 IWDTLNTPFFDDSLDYAPIPSGSGEEETFTFPLEGSEGYYSVMYSGPFPPLECSNLHP 140
BLAST of mRNA_L-elsbetiae_contig5866.14330.1 vs. uniprot
Match: A0A6H5K566_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K566_9PHAE) HSP 1 Score: 86.7 bits (213), Expect = 5.500e-18 Identity = 38/58 (65.52%), Postives = 44/58 (75.86%), Query Frame = 1 Query: 82 VLDTLNTPLMDDP-SYAPTPPGGGESATYRWPLEGTEGYYSLMYSGPMPPLQCPNLHP 252 + DTLNTP DD YAP P G GE T+ +PLEG+EGYYS+MYSGP PPL+C NLHP Sbjct: 143 IWDTLNTPFFDDSLDYAPIPSGSGEEETFTFPLEGSEGYYSVMYSGPFPPLECSNLHP 200
BLAST of mRNA_L-elsbetiae_contig5866.14330.1 vs. uniprot
Match: A0A6H5JNN6_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JNN6_9PHAE) HSP 1 Score: 77.8 bits (190), Expect = 7.070e-15 Identity = 34/53 (64.15%), Postives = 40/53 (75.47%), Query Frame = 1 Query: 82 VLDTLNTPLMDDP-SYAPTPPGGGESATYRWPLEGTEGYYSLMYSGPMPPLQC 237 + DTLNTP +D YAP P G GE T+ +PLEG+EGYYS+MYSGP PPLQC Sbjct: 17 IWDTLNTPFFEDSLDYAPIPSGSGEEETFTFPLEGSEGYYSVMYSGPFPPLQC 69
BLAST of mRNA_L-elsbetiae_contig5866.14330.1 vs. uniprot
Match: A0A6H5KQ76_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KQ76_9PHAE) HSP 1 Score: 76.6 bits (187), Expect = 1.800e-14 Identity = 38/65 (58.46%), Postives = 45/65 (69.23%), Query Frame = 1 Query: 82 VLDTLNTPLMDD---PS-YAPTPP----GGGESATYRWPLEGTEGYYSLMYSGPMPPLQCPNLHP 252 + D+LNTP D+ PS YAP P G E T+ WPLEG EGYYS+MYSGP PPL+CPNL+P Sbjct: 120 IWDSLNTPFFDEDNPPSDYAPIPTKFNDGIDEGDTFTWPLEGAEGYYSVMYSGPFPPLECPNLYP 184
BLAST of mRNA_L-elsbetiae_contig5866.14330.1 vs. uniprot
Match: D7FMV1_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FMV1_ECTSI) HSP 1 Score: 75.1 bits (183), Expect = 6.310e-14 Identity = 38/65 (58.46%), Postives = 44/65 (67.69%), Query Frame = 1 Query: 82 VLDTLNTPLMDD---PS-YAPTPP----GGGESATYRWPLEGTEGYYSLMYSGPMPPLQCPNLHP 252 + D+LNTP D+ PS YAP P G E T+ WPLEG EGYYS+MYSGP PPL+CPNL P Sbjct: 150 IWDSLNTPFFDEDDPPSDYAPIPTKYNDGIEEGDTFTWPLEGAEGYYSVMYSGPFPPLECPNLFP 214 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig5866.14330.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 6
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig5866.14330.1 >prot_L-elsbetiae_contig5866.14330.1 ID=prot_L-elsbetiae_contig5866.14330.1|Name=mRNA_L-elsbetiae_contig5866.14330.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=84bp HQRRDRRCAQRDEPVLLGDRIRKRRGAVLDTLNTPLMDDPSYAPTPPGGGback to top mRNA from alignment at L-elsbetiae_contig5866:1987..3567- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig5866.14330.1 ID=mRNA_L-elsbetiae_contig5866.14330.1|Name=mRNA_L-elsbetiae_contig5866.14330.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=1581bp|location=Sequence derived from alignment at L-elsbetiae_contig5866:1987..3567- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig5866:1987..3567- >mRNA_L-elsbetiae_contig5866.14330.1 ID=mRNA_L-elsbetiae_contig5866.14330.1|Name=mRNA_L-elsbetiae_contig5866.14330.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=504bp|location=Sequence derived from alignment at L-elsbetiae_contig5866:1987..3567- (Laminarionema elsbetiae ELsaHSoW15)back to top |