mRNA_L-elsbetiae_contig567.14027.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig567.14027.1 vs. uniprot
Match: D8LJE1_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LJE1_ECTSI) HSP 1 Score: 50.8 bits (120), Expect = 3.310e-5 Identity = 24/26 (92.31%), Postives = 24/26 (92.31%), Query Frame = 3 Query: 156 RLLFCSSHIGQVAVVRQLAPILHIGG 233 RLLFCSSHIGQVAVVRQL P LHIGG Sbjct: 82 RLLFCSSHIGQVAVVRQLTPSLHIGG 107
BLAST of mRNA_L-elsbetiae_contig567.14027.1 vs. uniprot
Match: A0A6H5L3V8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L3V8_9PHAE) HSP 1 Score: 50.8 bits (120), Expect = 3.980e-5 Identity = 24/26 (92.31%), Postives = 24/26 (92.31%), Query Frame = 3 Query: 156 RLLFCSSHIGQVAVVRQLAPILHIGG 233 RLLFCSSHIGQVAVVRQL P LHIGG Sbjct: 170 RLLFCSSHIGQVAVVRQLTPSLHIGG 195 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig567.14027.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig567.14027.1 >prot_L-elsbetiae_contig567.14027.1 ID=prot_L-elsbetiae_contig567.14027.1|Name=mRNA_L-elsbetiae_contig567.14027.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=104bp MHALHGALSCRAFLLCLAIHLAAFFVLQLIFPPGSLLFCLTASFLCSFSGback to top mRNA from alignment at L-elsbetiae_contig567:23563..23874+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig567.14027.1 ID=mRNA_L-elsbetiae_contig567.14027.1|Name=mRNA_L-elsbetiae_contig567.14027.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=312bp|location=Sequence derived from alignment at L-elsbetiae_contig567:23563..23874+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig567:23563..23874+ >mRNA_L-elsbetiae_contig567.14027.1 ID=mRNA_L-elsbetiae_contig567.14027.1|Name=mRNA_L-elsbetiae_contig567.14027.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=624bp|location=Sequence derived from alignment at L-elsbetiae_contig567:23563..23874+ (Laminarionema elsbetiae ELsaHSoW15)back to top |