mRNA_L-elsbetiae_contig21674.6638.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig21674.6638.1 vs. uniprot
Match: A0A6H5JT00_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JT00_9PHAE) HSP 1 Score: 54.7 bits (130), Expect = 4.930e-5 Identity = 25/40 (62.50%), Postives = 29/40 (72.50%), Query Frame = 2 Query: 179 SECYHHGCTKRPRYGVEGSKA-ELCTQHATEGMVNVVTKK 295 S+C H CTKRP YGV GSK E C+QHA +GMVNV K+ Sbjct: 62 SQCGHENCTKRPTYGVAGSKKREFCSQHARDGMVNVNNKR 101
BLAST of mRNA_L-elsbetiae_contig21674.6638.1 vs. uniprot
Match: D7FI73_ECTSI (EsV-1-7 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FI73_ECTSI) HSP 1 Score: 53.9 bits (128), Expect = 7.630e-5 Identity = 25/40 (62.50%), Postives = 29/40 (72.50%), Query Frame = 2 Query: 179 SECYHHGCTKRPRYGVEGSKA-ELCTQHATEGMVNVVTKK 295 S+C H CTKRP YGV GSK E C+QHA +GMVNV K+ Sbjct: 2 SQCGHANCTKRPTYGVAGSKKREFCSQHARDGMVNVNNKR 41 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig21674.6638.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig21674.6638.1 >prot_L-elsbetiae_contig21674.6638.1 ID=prot_L-elsbetiae_contig21674.6638.1|Name=mRNA_L-elsbetiae_contig21674.6638.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=189bp MPSECYHHGCTKRPRYGVEGSKAELCTQHATEGMVNVVTKKCGHQGCNVRback to top mRNA from alignment at L-elsbetiae_contig21674:839..1577+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig21674.6638.1 ID=mRNA_L-elsbetiae_contig21674.6638.1|Name=mRNA_L-elsbetiae_contig21674.6638.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=739bp|location=Sequence derived from alignment at L-elsbetiae_contig21674:839..1577+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig21674:839..1577+ >mRNA_L-elsbetiae_contig21674.6638.1 ID=mRNA_L-elsbetiae_contig21674.6638.1|Name=mRNA_L-elsbetiae_contig21674.6638.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=1134bp|location=Sequence derived from alignment at L-elsbetiae_contig21674:839..1577+ (Laminarionema elsbetiae ELsaHSoW15)back to top |