mRNA_L-elsbetiae_contig20450.6162.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig20450.6162.1 vs. uniprot
Match: W6Q5D8_PENRF (Carbohydrate-binding WSC n=2 Tax=Penicillium roqueforti TaxID=5082 RepID=W6Q5D8_PENRF) HSP 1 Score: 53.1 bits (126), Expect = 5.230e-7 Identity = 22/55 (40.00%), Postives = 33/55 (60.00%), Query Frame = 1 Query: 1 ALAEGSACYCGNPQPVDEER---GICEEPCAGDVSSMCGGVNSYDLYEIADNSLP 156 AL+ G+ CYCGN P D + C+ PCAG + CGG ++++L + A+N P Sbjct: 61 ALSRGNMCYCGNEMPPDSAKIADSKCDVPCAGWPAGSCGGADTFNLIQAAENLQP 115
BLAST of mRNA_L-elsbetiae_contig20450.6162.1 vs. uniprot
Match: A0A086TF94_ACRC1 (Galactose oxidase-like protein n=1 Tax=Acremonium chrysogenum (strain ATCC 11550 / CBS 779.69 / DSM 880 / IAM 14645 / JCM 23072 / IMI 49137) TaxID=857340 RepID=A0A086TF94_ACRC1) HSP 1 Score: 51.2 bits (121), Expect = 4.360e-6 Identity = 20/50 (40.00%), Postives = 31/50 (62.00%), Query Frame = 1 Query: 1 ALAEGSACYCGNPQPVDE------ERGICEEPCAGDVSSMCGGVNSYDLY 132 A+ G+ CYCG+P +D + G+C+ PCAG+ ++MCGG +S Y Sbjct: 68 AMGHGNICYCGDPANIDTAGAKFVDEGLCDIPCAGNGTAMCGGGSSLSTY 117
BLAST of mRNA_L-elsbetiae_contig20450.6162.1 vs. uniprot
Match: A0A6H5KL41_9PHAE (WSC domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KL41_9PHAE) HSP 1 Score: 48.5 bits (114), Expect = 3.070e-5 Identity = 19/51 (37.25%), Postives = 29/51 (56.86%), Query Frame = 1 Query: 1 ALAEGSACYCGNPQPV----DEERGICEEPCAGDVSSMCGGVNSYDLYEIA 141 A+ G C C D + G+C+ PC GD S CGGV+S+D+Y+++ Sbjct: 139 AVTRGDLCTCFTEADTGIFDDRKGGVCDAPCTGDSSQPCGGVDSFDVYQLS 189
BLAST of mRNA_L-elsbetiae_contig20450.6162.1 vs. uniprot
Match: A0A8K0TT44_9PEZI (WSC domain-containing protein n=1 Tax=Plectosphaerella cucumerina TaxID=40658 RepID=A0A8K0TT44_9PEZI) HSP 1 Score: 47.4 bits (111), Expect = 1.000e-4 Identity = 21/43 (48.84%), Postives = 23/43 (53.49%), Query Frame = 1 Query: 22 CYCGNP-----QPVDEERGICEEPCAGDVSSMCGGVNSYDLYE 135 CYCGN PV G+CE PC GD S +CGG LYE Sbjct: 409 CYCGNDVAADRAPVKGILGVCEMPCKGDNSQICGGYGGLSLYE 451 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig20450.6162.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig20450.6162.1 >prot_L-elsbetiae_contig20450.6162.1 ID=prot_L-elsbetiae_contig20450.6162.1|Name=mRNA_L-elsbetiae_contig20450.6162.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=52bp ALAEGSACYCGNPQPVDEERGICEEPCAGDVSSMCGGVNSYDLYEIADNSback to top mRNA from alignment at L-elsbetiae_contig20450:2242..2397- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig20450.6162.1 ID=mRNA_L-elsbetiae_contig20450.6162.1|Name=mRNA_L-elsbetiae_contig20450.6162.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=156bp|location=Sequence derived from alignment at L-elsbetiae_contig20450:2242..2397- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig20450:2242..2397- >mRNA_L-elsbetiae_contig20450.6162.1 ID=mRNA_L-elsbetiae_contig20450.6162.1|Name=mRNA_L-elsbetiae_contig20450.6162.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=312bp|location=Sequence derived from alignment at L-elsbetiae_contig20450:2242..2397- (Laminarionema elsbetiae ELsaHSoW15)back to top |