mRNA_L-elsbetiae_contig17734.5041.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig17734.5041.1 vs. uniprot
Match: A0A6H5KWQ4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KWQ4_9PHAE) HSP 1 Score: 98.6 bits (244), Expect = 9.220e-23 Identity = 47/49 (95.92%), Postives = 48/49 (97.96%), Query Frame = 1 Query: 10 VRRLSSSGDFGLVLVHAAAHIQVDPSDVSNDLDPRFTQHFHRSLKVLTQ 156 VRRLSSSGDFGLVLVHAAAHI VDPSD+SNDLDPRFTQHFHRSLKVLTQ Sbjct: 2894 VRRLSSSGDFGLVLVHAAAHIHVDPSDMSNDLDPRFTQHFHRSLKVLTQ 2942
BLAST of mRNA_L-elsbetiae_contig17734.5041.1 vs. uniprot
Match: D8LR26_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LR26_ECTSI) HSP 1 Score: 97.4 bits (241), Expect = 2.350e-22 Identity = 46/49 (93.88%), Postives = 48/49 (97.96%), Query Frame = 1 Query: 10 VRRLSSSGDFGLVLVHAAAHIQVDPSDVSNDLDPRFTQHFHRSLKVLTQ 156 VRRLSSSGDFGLVLVHAAAHI VDPSD++NDLDPRFTQHFHRSLKVLTQ Sbjct: 6579 VRRLSSSGDFGLVLVHAAAHIHVDPSDMTNDLDPRFTQHFHRSLKVLTQ 6627
BLAST of mRNA_L-elsbetiae_contig17734.5041.1 vs. uniprot
Match: A0A7S3GQ97_9STRA (Hypothetical protein n=1 Tax=Spumella elongata TaxID=89044 RepID=A0A7S3GQ97_9STRA) HSP 1 Score: 70.1 bits (170), Expect = 4.290e-13 Identity = 28/47 (59.57%), Postives = 42/47 (89.36%), Query Frame = 1 Query: 16 RLSSSGDFGLVLVHAAAHIQVDPSDVSNDLDPRFTQHFHRSLKVLTQ 156 RLSSSGDFGL+++HA +HI+V+P+D+SND DP+F F+++LK+L+Q Sbjct: 97 RLSSSGDFGLIVIHALSHIKVNPADLSNDADPKFLAEFYKNLKILSQ 143
BLAST of mRNA_L-elsbetiae_contig17734.5041.1 vs. uniprot
Match: A0A2E9D1H1_9GAMM (Uncharacterized protein n=1 Tax=Chromatiales bacterium TaxID=2026725 RepID=A0A2E9D1H1_9GAMM) HSP 1 Score: 66.2 bits (160), Expect = 2.190e-11 Identity = 28/47 (59.57%), Postives = 41/47 (87.23%), Query Frame = 1 Query: 16 RLSSSGDFGLVLVHAAAHIQVDPSDVSNDLDPRFTQHFHRSLKVLTQ 156 RLSSSGDFGLV +HA +HI+V+PSD+S+D +P+FT F+ +L++L+Q Sbjct: 516 RLSSSGDFGLVAIHALSHIKVNPSDMSDDSNPQFTAEFYTNLRILSQ 562
BLAST of mRNA_L-elsbetiae_contig17734.5041.1 vs. uniprot
Match: A0A835YHE9_9STRA (Uncharacterized protein (Fragment) n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YHE9_9STRA) HSP 1 Score: 53.9 bits (128), Expect = 9.300e-8 Identity = 27/50 (54.00%), Postives = 34/50 (68.00%), Query Frame = 1 Query: 13 RRLSSSGDFGLVLVHAAAHIQVD--PSDVSNDLDPRFTQHFHRSLKVLTQ 156 RRL SGDFGLVLVHAAAH+ D P+ + +D P FT+ FH +L L + Sbjct: 77 RRLGGSGDFGLVLVHAAAHLLSDAAPAHLHDDARPEFTRAFHGALATLAR 126 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig17734.5041.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 5
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig17734.5041.1 >prot_L-elsbetiae_contig17734.5041.1 ID=prot_L-elsbetiae_contig17734.5041.1|Name=mRNA_L-elsbetiae_contig17734.5041.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=52bp MATVRRLSSSGDFGLVLVHAAAHIQVDPSDVSNDLDPRFTQHFHRSLKVLback to top mRNA from alignment at L-elsbetiae_contig17734:2683..2838- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig17734.5041.1 ID=mRNA_L-elsbetiae_contig17734.5041.1|Name=mRNA_L-elsbetiae_contig17734.5041.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=156bp|location=Sequence derived from alignment at L-elsbetiae_contig17734:2683..2838- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig17734:2683..2838- >mRNA_L-elsbetiae_contig17734.5041.1 ID=mRNA_L-elsbetiae_contig17734.5041.1|Name=mRNA_L-elsbetiae_contig17734.5041.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=312bp|location=Sequence derived from alignment at L-elsbetiae_contig17734:2683..2838- (Laminarionema elsbetiae ELsaHSoW15)back to top |