mRNA_L-elsbetiae_contig177.5016.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig177.5016.1 vs. uniprot
Match: Q6XLU8_9PHYC (FirrV-1-H2 n=1 Tax=Feldmannia irregularis virus a TaxID=231992 RepID=Q6XLU8_9PHYC) HSP 1 Score: 68.6 bits (166), Expect = 8.620e-12 Identity = 32/50 (64.00%), Postives = 39/50 (78.00%), Query Frame = 1 Query: 1 MKKEQVTFLATIGLVCTGLSQLRDDDP-MRAQFGPVTAYQMSHFVMYLSI 147 MKK ++ FLATIGLVC LSQL DDDP +++Q GP+T YQ SHF+MY I Sbjct: 11 MKKNEIAFLATIGLVCGALSQLHDDDPVLQSQVGPLTGYQASHFLMYFII 60 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig177.5016.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig177.5016.1 >prot_L-elsbetiae_contig177.5016.1 ID=prot_L-elsbetiae_contig177.5016.1|Name=mRNA_L-elsbetiae_contig177.5016.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=50bp MKKEQVTFLATIGLVCTGLSQLRDDDPMRAQFGPVTAYQMSHFVMYLSI*back to top mRNA from alignment at L-elsbetiae_contig177:22196..22623- Legend: polypeptideCDSUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig177.5016.1 ID=mRNA_L-elsbetiae_contig177.5016.1|Name=mRNA_L-elsbetiae_contig177.5016.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=428bp|location=Sequence derived from alignment at L-elsbetiae_contig177:22196..22623- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig177:22196..22623- >mRNA_L-elsbetiae_contig177.5016.1 ID=mRNA_L-elsbetiae_contig177.5016.1|Name=mRNA_L-elsbetiae_contig177.5016.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=300bp|location=Sequence derived from alignment at L-elsbetiae_contig177:22196..22623- (Laminarionema elsbetiae ELsaHSoW15)back to top |