mRNA_L-elsbetiae_contig13904.2937.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig13904.2937.1 vs. uniprot
Match: D8LMQ5_ECTSI (Pol1-like DNA polymerase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LMQ5_ECTSI) HSP 1 Score: 52.0 bits (123), Expect = 1.170e-6 Identity = 27/37 (72.97%), Postives = 32/37 (86.49%), Query Frame = 1 Query: 1 EREAVDFTKLTVPALRDILRKKELKVSGKKAELIERL 111 E E VD++KLTVP L+DILR K+LKVSG+K ELIERL Sbjct: 362 EAEVVDYSKLTVPKLKDILRAKKLKVSGRKEELIERL 398
BLAST of mRNA_L-elsbetiae_contig13904.2937.1 vs. uniprot
Match: A0A6H5K9D2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K9D2_9PHAE) HSP 1 Score: 51.2 bits (121), Expect = 2.200e-6 Identity = 27/37 (72.97%), Postives = 32/37 (86.49%), Query Frame = 1 Query: 1 EREAVDFTKLTVPALRDILRKKELKVSGKKAELIERL 111 E E VD++KLTVP L+DILR K+LKVSG+K ELIERL Sbjct: 492 EVEVVDYSKLTVPKLKDILRAKKLKVSGRKEELIERL 528
BLAST of mRNA_L-elsbetiae_contig13904.2937.1 vs. uniprot
Match: K0T5H2_THAOC (SAP domain-containing protein n=1 Tax=Thalassiosira oceanica TaxID=159749 RepID=K0T5H2_THAOC) HSP 1 Score: 48.5 bits (114), Expect = 1.980e-5 Identity = 24/37 (64.86%), Postives = 31/37 (83.78%), Query Frame = 1 Query: 1 EREAVDFTKLTVPALRDILRKKELKVSGKKAELIERL 111 E E +D++K+TV L+D+LR K +KVSGKKAELIERL Sbjct: 539 EEEPIDYSKMTVAQLKDLLRSKGMKVSGKKAELIERL 575 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig13904.2937.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig13904.2937.1 >prot_L-elsbetiae_contig13904.2937.1 ID=prot_L-elsbetiae_contig13904.2937.1|Name=mRNA_L-elsbetiae_contig13904.2937.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=37bp EREAVDFTKLTVPALRDILRKKELKVSGKKAELIERLback to top mRNA from alignment at L-elsbetiae_contig13904:4305..4415+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig13904.2937.1 ID=mRNA_L-elsbetiae_contig13904.2937.1|Name=mRNA_L-elsbetiae_contig13904.2937.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=111bp|location=Sequence derived from alignment at L-elsbetiae_contig13904:4305..4415+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig13904:4305..4415+ >mRNA_L-elsbetiae_contig13904.2937.1 ID=mRNA_L-elsbetiae_contig13904.2937.1|Name=mRNA_L-elsbetiae_contig13904.2937.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=222bp|location=Sequence derived from alignment at L-elsbetiae_contig13904:4305..4415+ (Laminarionema elsbetiae ELsaHSoW15)back to top |