mRNA_L-elsbetiae_contig1282.2270.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig1282.2270.1 vs. uniprot
Match: D8LT96_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LT96_ECTSI) HSP 1 Score: 109 bits (272), Expect = 1.060e-26 Identity = 46/52 (88.46%), Postives = 50/52 (96.15%), Query Frame = 1 Query: 1 WNEDEGFFKVNQTLTGDFVLIARFKGTDGGAETGPEGVLFRYCNHTCFLPEG 156 WNED+GFFKVN+ LTGDFV+IARFKGTDG AETGPEGVLFRYCNHTCFLP+G Sbjct: 279 WNEDQGFFKVNKPLTGDFVVIARFKGTDGAAETGPEGVLFRYCNHTCFLPQG 330
BLAST of mRNA_L-elsbetiae_contig1282.2270.1 vs. uniprot
Match: A0A6H5JR06_9PHAE (FMN protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JR06_9PHAE) HSP 1 Score: 109 bits (272), Expect = 1.510e-26 Identity = 46/52 (88.46%), Postives = 50/52 (96.15%), Query Frame = 1 Query: 1 WNEDEGFFKVNQTLTGDFVLIARFKGTDGGAETGPEGVLFRYCNHTCFLPEG 156 WNED+GFFKVN+ LTGDFV+IARFKGTDG AETGPEGVLFRYCNHTCFLP+G Sbjct: 279 WNEDQGFFKVNKPLTGDFVVIARFKGTDGAAETGPEGVLFRYCNHTCFLPQG 330
BLAST of mRNA_L-elsbetiae_contig1282.2270.1 vs. uniprot
Match: A0A7S2E4S0_9STRA (Hypothetical protein (Fragment) n=1 Tax=Ditylum brightwellii TaxID=49249 RepID=A0A7S2E4S0_9STRA) HSP 1 Score: 60.1 bits (144), Expect = 3.270e-9 Identity = 25/50 (50.00%), Postives = 34/50 (68.00%), Query Frame = 1 Query: 1 WNEDEGFFKVNQTLTGDFVLIARFKGTDGGAETGPEGVLFRYCNHTCFLP 150 W ++EGF++VN+ L GDFV++ RF G P VLFRYCN+T F+P Sbjct: 609 WADEEGFYRVNRLLIGDFVILVRFGGPYSYDLEDPTKVLFRYCNNTSFMP 658
BLAST of mRNA_L-elsbetiae_contig1282.2270.1 vs. uniprot
Match: A0A1Z5JS78_FISSO (Uncharacterized protein n=1 Tax=Fistulifera solaris TaxID=1519565 RepID=A0A1Z5JS78_FISSO) HSP 1 Score: 59.3 bits (142), Expect = 6.080e-9 Identity = 27/52 (51.92%), Postives = 32/52 (61.54%), Query Frame = 1 Query: 1 WNEDEGFFKVNQTLTGDFVLIARFKGTDGGAETGPEGVLFRYCNHTCFLPEG 156 W E+EGFF VNQ L GDF L+ RF G G + P ++FRY N T FL G Sbjct: 370 WEEEEGFFPVNQILDGDFYLLCRFGGHYAGDLSDPSKIIFRYANTTGFLGAG 421
BLAST of mRNA_L-elsbetiae_contig1282.2270.1 vs. uniprot
Match: A0A1Z5JJ85_FISSO (C2 tensin-type domain-containing protein n=1 Tax=Fistulifera solaris TaxID=1519565 RepID=A0A1Z5JJ85_FISSO) HSP 1 Score: 57.4 bits (137), Expect = 2.270e-8 Identity = 26/52 (50.00%), Postives = 31/52 (59.62%), Query Frame = 1 Query: 1 WNEDEGFFKVNQTLTGDFVLIARFKGTDGGAETGPEGVLFRYCNHTCFLPEG 156 W E+EGFF VNQ L GDF L+ RF G + P ++FRY N T FL G Sbjct: 154 WEEEEGFFPVNQILEGDFYLLCRFGGHYADDLSDPSKIIFRYANTTSFLGAG 205
BLAST of mRNA_L-elsbetiae_contig1282.2270.1 vs. uniprot
Match: A0A1E7EJM2_9STRA (C2 tensin-type domain-containing protein (Fragment) n=1 Tax=Fragilariopsis cylindrus CCMP1102 TaxID=635003 RepID=A0A1E7EJM2_9STRA) HSP 1 Score: 51.2 bits (121), Expect = 4.390e-6 Identity = 23/57 (40.35%), Postives = 34/57 (59.65%), Query Frame = 1 Query: 1 WNEDEGFFKVNQTLTGDFVLIARFKGTDGGAETG-----PEGVLFRYCNHTCFLPEG 156 W ++EGF+++N L G+F+L+ RF G+ E+ P +LFRY N T FL G Sbjct: 736 WVDEEGFYRINVVLDGEFLLLCRFGGSSSTTESSRIIHDPSKILFRYTNTTGFLSGG 792
BLAST of mRNA_L-elsbetiae_contig1282.2270.1 vs. uniprot
Match: A0A7S3Q062_9STRA (Hypothetical protein (Fragment) n=1 Tax=Chaetoceros debilis TaxID=122233 RepID=A0A7S3Q062_9STRA) HSP 1 Score: 50.4 bits (119), Expect = 8.210e-6 Identity = 20/49 (40.82%), Postives = 31/49 (63.27%), Query Frame = 1 Query: 1 WNEDEGFFKVNQTLTGDFVLIARFKGTDGGAETGPEGVLFRYCNHTCFL 147 W ++EGF++VN+ + GDF+L+ RF G P V+ RY N+T +L Sbjct: 503 WADEEGFYRVNKGIWGDFLLLCRFGGQHSQDTDDPTKVILRYANNTSYL 551
BLAST of mRNA_L-elsbetiae_contig1282.2270.1 vs. uniprot
Match: B7FZW8_PHATC (Formin like protein n=1 Tax=Phaeodactylum tricornutum (strain CCAP 1055/1) TaxID=556484 RepID=B7FZW8_PHATC) HSP 1 Score: 48.5 bits (114), Expect = 3.950e-5 Identity = 24/53 (45.28%), Postives = 28/53 (52.83%), Query Frame = 1 Query: 1 WNEDEGFFKVNQTLTGDFVLIARFKGTDGGAETGPEGV-LFRYCNHTCFLPEG 156 W ++EGFFKVN L GDF L+ RF G G LFRY N T + G Sbjct: 373 WADEEGFFKVNVVLEGDFCLLCRFGGAHANKGLGETSTQLFRYVNTTVAMSTG 425 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig1282.2270.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 8
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig1282.2270.1 >prot_L-elsbetiae_contig1282.2270.1 ID=prot_L-elsbetiae_contig1282.2270.1|Name=mRNA_L-elsbetiae_contig1282.2270.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=52bp WNEDEGFFKVNQTLTGDFVLIARFKGTDGGAETGPEGVLFRYCNHTCFLPback to top mRNA from alignment at L-elsbetiae_contig1282:27135..27290+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig1282.2270.1 ID=mRNA_L-elsbetiae_contig1282.2270.1|Name=mRNA_L-elsbetiae_contig1282.2270.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=156bp|location=Sequence derived from alignment at L-elsbetiae_contig1282:27135..27290+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig1282:27135..27290+ >mRNA_L-elsbetiae_contig1282.2270.1 ID=mRNA_L-elsbetiae_contig1282.2270.1|Name=mRNA_L-elsbetiae_contig1282.2270.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=312bp|location=Sequence derived from alignment at L-elsbetiae_contig1282:27135..27290+ (Laminarionema elsbetiae ELsaHSoW15)back to top |