mRNA_L-elsbetiae_contig12670.2152.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig12670.2152.1 vs. uniprot
Match: A0A6H5KL74_9PHAE (F5/8 type C domain-containing protein n=3 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5KL74_9PHAE) HSP 1 Score: 76.3 bits (186), Expect = 2.640e-14 Identity = 42/83 (50.60%), Postives = 57/83 (68.67%), Query Frame = 1 Query: 4 PTTDGFEFTTDSNDATGGTIFFDLAGFFVVTEVQLQFPVGDTYKFDLSVSSR----ESTTLITDLESVDTAGFQSFDVASFTD 240 PTTD F++TTDS+DA G T+ F+LA + +V V+++FPVGDTYKFDL ++ E IT ES DTA +QSFD++ D Sbjct: 694 PTTDAFDWTTDSDDAIGRTVEFELAWYAMVDAVEIKFPVGDTYKFDLELNDDQIRGEILKTITGFESADTADWQSFDLSQHLD 776
BLAST of mRNA_L-elsbetiae_contig12670.2152.1 vs. uniprot
Match: A0A6H5KFA6_9PHAE (F5/8 type C domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5KFA6_9PHAE) HSP 1 Score: 65.5 bits (158), Expect = 1.630e-10 Identity = 35/69 (50.72%), Postives = 49/69 (71.01%), Query Frame = 1 Query: 1 EPTTDGFEFTTDSNDATGGTIFFDLAGFFVVTEVQLQFPVGDTYKFDLSVSSR-----ESTTLITDLES 192 EPTTDGFE++++SN+A ++ LAG+ VTE+QL FP GDTYKFD+++ + E+ T IT LES Sbjct: 704 EPTTDGFEWSSNSNEAIDQSLTLSLAGYHTVTELQLMFPEGDTYKFDVTLFNNLDGTGEAYTTITGLES 772
BLAST of mRNA_L-elsbetiae_contig12670.2152.1 vs. uniprot
Match: D7FTH1_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FTH1_ECTSI) HSP 1 Score: 60.1 bits (144), Expect = 1.290e-8 Identity = 33/80 (41.25%), Postives = 54/80 (67.50%), Query Frame = 1 Query: 7 TTDGFEFTTDSNDATGGTIFFDLAGFFVVTEVQLQFPVGDTYKFDLSV--SSRESTTLITDLESVDTAGFQSFDVASFTD 240 TTD FE++++S++A T+ F L + ++ V+LQFPVG+TYKF+L++ E + T LESVD+ G+Q F++ + D Sbjct: 691 TTDAFEWSSESDEAMDRTLSFVLNSYALMEAVELQFPVGETYKFELTLYDDGDEIVSTFTGLESVDSEGWQRFELGTIDD 770
BLAST of mRNA_L-elsbetiae_contig12670.2152.1 vs. uniprot
Match: A0A6H5KH45_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KH45_9PHAE) HSP 1 Score: 52.8 bits (125), Expect = 4.860e-6 Identity = 30/80 (37.50%), Postives = 49/80 (61.25%), Query Frame = 1 Query: 7 TTDGFEFTTDSNDATGGTIFFDLAGFFVVTEVQLQFPVGDTYKFDLSVSSRES--TTLITDLESVDTAGFQSFDVASFTD 240 TTD F + ++S+ A + F L + V+ V+LQFP+G+TYKF+L++ E + T ESVD+ G+Q F++ + D Sbjct: 506 TTDAFVWASESDAAIDEKLSFVLKSYAVMEAVELQFPIGETYKFELTLYDDEDEIVSTFTGFESVDSEGWQRFELGTIDD 585 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig12670.2152.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig12670.2152.1 >prot_L-elsbetiae_contig12670.2152.1 ID=prot_L-elsbetiae_contig12670.2152.1|Name=mRNA_L-elsbetiae_contig12670.2152.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=85bp EPTTDGFEFTTDSNDATGGTIFFDLAGFFVVTEVQLQFPVGDTYKFDLSVback to top mRNA from alignment at L-elsbetiae_contig12670:4528..4941- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig12670.2152.1 ID=mRNA_L-elsbetiae_contig12670.2152.1|Name=mRNA_L-elsbetiae_contig12670.2152.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=414bp|location=Sequence derived from alignment at L-elsbetiae_contig12670:4528..4941- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig12670:4528..4941- >mRNA_L-elsbetiae_contig12670.2152.1 ID=mRNA_L-elsbetiae_contig12670.2152.1|Name=mRNA_L-elsbetiae_contig12670.2152.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=510bp|location=Sequence derived from alignment at L-elsbetiae_contig12670:4528..4941- (Laminarionema elsbetiae ELsaHSoW15)back to top |