mRNA_L-elsbetiae_contig12664.2145.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig12664.2145.1 vs. uniprot
Match: D8LDI4_ECTSI (Ubiquitin carboxyl-terminal hydrolase n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LDI4_ECTSI) HSP 1 Score: 98.2 bits (243), Expect = 1.320e-22 Identity = 45/45 (100.00%), Postives = 45/45 (100.00%), Query Frame = 1 Query: 4 VELNKSYDFNKITEAGAKLRPLSGPGFTGIKNLGNSCYMNSCLQV 138 VELNKSYDFNKITEAGAKLRPLSGPGFTGIKNLGNSCYMNSCLQV Sbjct: 355 VELNKSYDFNKITEAGAKLRPLSGPGFTGIKNLGNSCYMNSCLQV 399
BLAST of mRNA_L-elsbetiae_contig12664.2145.1 vs. uniprot
Match: A0A836CMU5_9STRA (Ubiquitin carboxyl-terminal hydrolase n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CMU5_9STRA) HSP 1 Score: 87.4 bits (215), Expect = 8.080e-19 Identity = 38/45 (84.44%), Postives = 42/45 (93.33%), Query Frame = 1 Query: 4 VELNKSYDFNKITEAGAKLRPLSGPGFTGIKNLGNSCYMNSCLQV 138 VELNKSYDF+KITEAG KL PL GPG+TG+KNLGNSCYMNSCLQ+ Sbjct: 323 VELNKSYDFSKITEAGKKLTPLQGPGYTGLKNLGNSCYMNSCLQL 367
BLAST of mRNA_L-elsbetiae_contig12664.2145.1 vs. uniprot
Match: A0A7S2V2B3_9STRA (Ubiquitinyl hydrolase 1 (Fragment) n=1 Tax=Fibrocapsa japonica TaxID=94617 RepID=A0A7S2V2B3_9STRA) HSP 1 Score: 80.9 bits (198), Expect = 3.970e-17 Identity = 37/45 (82.22%), Postives = 41/45 (91.11%), Query Frame = 1 Query: 4 VELNKSYDFNKITEAGAKLRPLSGPGFTGIKNLGNSCYMNSCLQV 138 VELNK+YDF+KITEAGA+L PL G GFTGIKNLGNSCY+NS LQV Sbjct: 199 VELNKTYDFSKITEAGAQLEPLYGAGFTGIKNLGNSCYINSVLQV 243
BLAST of mRNA_L-elsbetiae_contig12664.2145.1 vs. uniprot
Match: A0A7S0N978_9CHLO (Ubiquitinyl hydrolase 1 (Fragment) n=1 Tax=Pyramimonas obovata TaxID=1411642 RepID=A0A7S0N978_9CHLO) HSP 1 Score: 80.1 bits (196), Expect = 2.950e-16 Identity = 35/45 (77.78%), Postives = 41/45 (91.11%), Query Frame = 1 Query: 4 VELNKSYDFNKITEAGAKLRPLSGPGFTGIKNLGNSCYMNSCLQV 138 VELNKS++F+KITEAGA L PLSGPG+ G+KNLGNSCYMNS +QV Sbjct: 295 VELNKSFEFDKITEAGADLAPLSGPGYVGLKNLGNSCYMNSVMQV 339
BLAST of mRNA_L-elsbetiae_contig12664.2145.1 vs. uniprot
Match: A0A8J9RIB1_9CHLO (Ubiquitin carboxyl-terminal hydrolase 5 n=1 Tax=Coccomyxa sp. Obi TaxID=2315456 RepID=A0A8J9RIB1_9CHLO) HSP 1 Score: 75.1 bits (183), Expect = 1.740e-14 Identity = 31/45 (68.89%), Postives = 40/45 (88.89%), Query Frame = 1 Query: 4 VELNKSYDFNKITEAGAKLRPLSGPGFTGIKNLGNSCYMNSCLQV 138 ++LN S++F+K+TE+GA L PL+GPGF G+KNLGNSCYMNS LQV Sbjct: 303 IDLNMSFEFDKMTESGAALEPLTGPGFVGLKNLGNSCYMNSVLQV 347
BLAST of mRNA_L-elsbetiae_contig12664.2145.1 vs. uniprot
Match: I0YIM7_COCSC (Ubiquitin carboxyl-terminal hydrolase n=1 Tax=Coccomyxa subellipsoidea (strain C-169) TaxID=574566 RepID=I0YIM7_COCSC) HSP 1 Score: 74.7 bits (182), Expect = 2.380e-14 Identity = 31/45 (68.89%), Postives = 39/45 (86.67%), Query Frame = 1 Query: 4 VELNKSYDFNKITEAGAKLRPLSGPGFTGIKNLGNSCYMNSCLQV 138 ++LN S++F+KITE+G L PLSGPG+ G+KNLGNSCYMNS LQV Sbjct: 303 IDLNMSFEFDKITESGTALEPLSGPGYVGLKNLGNSCYMNSVLQV 347
BLAST of mRNA_L-elsbetiae_contig12664.2145.1 vs. uniprot
Match: A0A2P6U3W2_CHLSO (Ubiquitin carboxyl-terminal hydrolase n=1 Tax=Chlorella sorokiniana TaxID=3076 RepID=A0A2P6U3W2_CHLSO) HSP 1 Score: 73.6 bits (179), Expect = 6.070e-14 Identity = 33/45 (73.33%), Postives = 37/45 (82.22%), Query Frame = 1 Query: 4 VELNKSYDFNKITEAGAKLRPLSGPGFTGIKNLGNSCYMNSCLQV 138 +ELN SY+F+KITEAG L LSGPG G+KNLGNSCYMNS LQV Sbjct: 294 IELNLSYEFDKITEAGEALEALSGPGLVGLKNLGNSCYMNSVLQV 338
BLAST of mRNA_L-elsbetiae_contig12664.2145.1 vs. uniprot
Match: A0A7S1BZZ8_9STRA (Hypothetical protein (Fragment) n=1 Tax=Corethron hystrix TaxID=216773 RepID=A0A7S1BZZ8_9STRA) HSP 1 Score: 72.0 bits (175), Expect = 2.030e-13 Identity = 34/50 (68.00%), Postives = 42/50 (84.00%), Query Frame = 1 Query: 4 VELNKSYDFNKITEAGAKLRPLSGPGFTGIKNLGNSCYMNSCLQV-WSGL 150 VELN SY F+ ITEAGA+LRP+SGPG+ + NLGNSCY+NS LQ+ +SGL Sbjct: 168 VELNASYAFDAITEAGAELRPISGPGYQSLVNLGNSCYINSVLQLLYSGL 217
BLAST of mRNA_L-elsbetiae_contig12664.2145.1 vs. uniprot
Match: A0A2V0PBV4_9CHLO (Ubiquitinyl hydrolase 1 n=1 Tax=Raphidocelis subcapitata TaxID=307507 RepID=A0A2V0PBV4_9CHLO) HSP 1 Score: 72.0 bits (175), Expect = 2.110e-13 Identity = 32/45 (71.11%), Postives = 37/45 (82.22%), Query Frame = 1 Query: 4 VELNKSYDFNKITEAGAKLRPLSGPGFTGIKNLGNSCYMNSCLQV 138 V+LN ++F+ ITEAGA L PLSGPG G+ NLGNSCYMNSCLQV Sbjct: 280 VDLNMRFEFDAITEAGAHLVPLSGPGHVGLVNLGNSCYMNSCLQV 324
BLAST of mRNA_L-elsbetiae_contig12664.2145.1 vs. uniprot
Match: A0A8J4EZ50_9CHLO (Ubiquitin carboxyl-terminal hydrolase n=1 Tax=Volvox africanus TaxID=51714 RepID=A0A8J4EZ50_9CHLO) HSP 1 Score: 72.0 bits (175), Expect = 2.120e-13 Identity = 31/45 (68.89%), Postives = 39/45 (86.67%), Query Frame = 1 Query: 4 VELNKSYDFNKITEAGAKLRPLSGPGFTGIKNLGNSCYMNSCLQV 138 +LN SY+F++I E+GA+L+PLSGPG TG+ NLGNSCYMNS LQV Sbjct: 299 ADLNTSYEFSRIMESGAELQPLSGPGLTGLINLGNSCYMNSVLQV 343 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig12664.2145.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig12664.2145.1 >prot_L-elsbetiae_contig12664.2145.1 ID=prot_L-elsbetiae_contig12664.2145.1|Name=mRNA_L-elsbetiae_contig12664.2145.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=53bp KVELNKSYDFNKITEAGAKLRPLSGPGFTGIKNLGNSCYMNSCLQVWSGLback to top mRNA from alignment at L-elsbetiae_contig12664:4673..4831- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig12664.2145.1 ID=mRNA_L-elsbetiae_contig12664.2145.1|Name=mRNA_L-elsbetiae_contig12664.2145.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=159bp|location=Sequence derived from alignment at L-elsbetiae_contig12664:4673..4831- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig12664:4673..4831- >mRNA_L-elsbetiae_contig12664.2145.1 ID=mRNA_L-elsbetiae_contig12664.2145.1|Name=mRNA_L-elsbetiae_contig12664.2145.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=318bp|location=Sequence derived from alignment at L-elsbetiae_contig12664:4673..4831- (Laminarionema elsbetiae ELsaHSoW15)back to top |