mRNA_L-elsbetiae_contig12453.1998.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig12453.1998.1 vs. uniprot
Match: D7G330_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G330_ECTSI) HSP 1 Score: 97.1 bits (240), Expect = 1.340e-20 Identity = 49/63 (77.78%), Postives = 50/63 (79.37%), Query Frame = 2 Query: 329 GGLCTAVLNAKGMVDKASDNQVKLEKLCEWCCGITV*VT--------LMINVSPLEDCVKELE 493 GGLCTAVLNAK MVDKASDNQ KLEKLCE CCGITV V LM+NVSPLEDCVKELE Sbjct: 34 GGLCTAVLNAKDMVDKASDNQAKLEKLCERCCGITVQVVEKLKGPTPLMVNVSPLEDCVKELE 96
BLAST of mRNA_L-elsbetiae_contig12453.1998.1 vs. uniprot
Match: A0A6H5K0A6_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K0A6_9PHAE) HSP 1 Score: 79.0 bits (193), Expect = 4.500e-14 Identity = 41/57 (71.93%), Postives = 43/57 (75.44%), Query Frame = 2 Query: 329 GGLCTAVLNAKGMVDKASDNQVKLEKLCEWCCGITV*V--------TLMINVSPLED 475 GGLCTAVLNA MVDKAS+NQ KLEKLCE CCGITV V +L INVSPLED Sbjct: 5 GGLCTAVLNANVMVDKASNNQAKLEKLCESCCGITVQVVEKLQGSRSLTINVSPLED 61 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig12453.1998.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig12453.1998.1 >prot_L-elsbetiae_contig12453.1998.1 ID=prot_L-elsbetiae_contig12453.1998.1|Name=mRNA_L-elsbetiae_contig12453.1998.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=93bp EKVSCPENHLFCADRLPLSQQQGERTKPHRKETAVVEVLLYFGGGRTPSPback to top mRNA from alignment at L-elsbetiae_contig12453:2063..2883- Legend: polypeptideCDSUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig12453.1998.1 ID=mRNA_L-elsbetiae_contig12453.1998.1|Name=mRNA_L-elsbetiae_contig12453.1998.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=821bp|location=Sequence derived from alignment at L-elsbetiae_contig12453:2063..2883- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig12453:2063..2883- >mRNA_L-elsbetiae_contig12453.1998.1 ID=mRNA_L-elsbetiae_contig12453.1998.1|Name=mRNA_L-elsbetiae_contig12453.1998.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=558bp|location=Sequence derived from alignment at L-elsbetiae_contig12453:2063..2883- (Laminarionema elsbetiae ELsaHSoW15)back to top |