mRNA_L-elsbetiae_contig12157.1795.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig12157.1795.1 vs. uniprot
Match: A0A6H5K075_9PHAE (DUF4470 domain-containing protein (Fragment) n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5K075_9PHAE) HSP 1 Score: 88.6 bits (218), Expect = 3.040e-19 Identity = 45/52 (86.54%), Postives = 48/52 (92.31%), Query Frame = 1 Query: 1 FDFIDSSYLADTLGIMNVVMAASPLLKPSPHAVLRTDLRRSGHARKRLTRAK 156 FD IDSSYLA+ LGI+NVVMA SPLLKPSPHAV+RTDLRRSG ARKRLTRAK Sbjct: 505 FDLIDSSYLANNLGILNVVMATSPLLKPSPHAVVRTDLRRSGPARKRLTRAK 556
BLAST of mRNA_L-elsbetiae_contig12157.1795.1 vs. uniprot
Match: A0A4V1ISJ4_9FUNG (Uncharacterized protein n=1 Tax=Blyttiomyces helicus TaxID=388810 RepID=A0A4V1ISJ4_9FUNG) HSP 1 Score: 48.1 bits (113), Expect = 5.360e-5 Identity = 21/37 (56.76%), Postives = 28/37 (75.68%), Query Frame = 1 Query: 1 FDFIDSSYLADTLGIMNVVMAASPLLKPSPHAVLRTD 111 FD ID+S L D LG++N+++A PLLKP HA+L TD Sbjct: 374 FDVIDTSNLTDHLGLLNILVATGPLLKPVLHAILHTD 410
BLAST of mRNA_L-elsbetiae_contig12157.1795.1 vs. uniprot
Match: A0A0C4DWY8_MAGP6 (MYND-type zinc finger protein samB n=1 Tax=Magnaporthiopsis poae (strain ATCC 64411 / 73-15) TaxID=644358 RepID=A0A0C4DWY8_MAGP6) HSP 1 Score: 48.1 bits (113), Expect = 5.390e-5 Identity = 21/38 (55.26%), Postives = 30/38 (78.95%), Query Frame = 1 Query: 1 FDFIDSSYLADTLGIMNVVMAASPLLKPSPHAVLRTDL 114 FD ID+S LAD+LG +N++ +A PLLKP+P A L T++ Sbjct: 379 FDAIDTSNLADSLGALNILFSAGPLLKPAPWAALSTEM 416 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig12157.1795.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig12157.1795.1 >prot_L-elsbetiae_contig12157.1795.1 ID=prot_L-elsbetiae_contig12157.1795.1|Name=mRNA_L-elsbetiae_contig12157.1795.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=52bp FDFIDSSYLADTLGIMNVVMAASPLLKPSPHAVLRTDLRRSGHARKRLTRback to top mRNA from alignment at L-elsbetiae_contig12157:583..738- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig12157.1795.1 ID=mRNA_L-elsbetiae_contig12157.1795.1|Name=mRNA_L-elsbetiae_contig12157.1795.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=156bp|location=Sequence derived from alignment at L-elsbetiae_contig12157:583..738- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig12157:583..738- >mRNA_L-elsbetiae_contig12157.1795.1 ID=mRNA_L-elsbetiae_contig12157.1795.1|Name=mRNA_L-elsbetiae_contig12157.1795.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=312bp|location=Sequence derived from alignment at L-elsbetiae_contig12157:583..738- (Laminarionema elsbetiae ELsaHSoW15)back to top |