mRNA_L-elsbetiae_contig11537.1347.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig11537.1347.1 vs. uniprot
Match: D8LSW6_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LSW6_ECTSI) HSP 1 Score: 78.2 bits (191), Expect = 5.140e-15 Identity = 43/63 (68.25%), Postives = 47/63 (74.60%), Query Frame = 2 Query: 2 STSESWVSLKRMETILLMEENEILTAPLREFDLAVKPQEGPPPKLLAVVPVLVSPAPIGLGST 190 +TSESWVS+KRMETILLMEENE LTAPLREFDLA+KP +G PP A S P G GST Sbjct: 373 TTSESWVSIKRMETILLMEENETLTAPLREFDLAIKPDKGMPPNPPASAAAAAS-TPTGSGST 434
BLAST of mRNA_L-elsbetiae_contig11537.1347.1 vs. uniprot
Match: A0A6H5JDN6_9PHAE (ABC protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JDN6_9PHAE) HSP 1 Score: 75.5 bits (184), Expect = 4.560e-14 Identity = 44/69 (63.77%), Postives = 48/69 (69.57%), Query Frame = 2 Query: 2 STSESWVSLKRMETILLMEENEILTAPLREFDLAVKPQEGPPPKLLAVVPVLVSPA--PIGLGSTASPP 202 +TSESWVS+KRMETILLMEENE L APLREFDLA+KP + PP A A P G GST SPP Sbjct: 186 TTSESWVSIKRMETILLMEENETLIAPLREFDLAIKPDKRVPPNPPAAXXXXXXEASTPTGSGSTPSPP 254
BLAST of mRNA_L-elsbetiae_contig11537.1347.1 vs. uniprot
Match: A0A6H5JDL0_9PHAE (ABC protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JDL0_9PHAE) HSP 1 Score: 71.6 bits (174), Expect = 1.030e-12 Identity = 34/41 (82.93%), Postives = 38/41 (92.68%), Query Frame = 2 Query: 11 ESWVSLKRMETILLMEENEILTAPLREFDLAVKPQEGPPPK 133 ESWVS+KR+ETILLMEENE LTAPLREFDLA+KP +G PPK Sbjct: 186 ESWVSIKRIETILLMEENEDLTAPLREFDLAIKPDKGAPPK 226 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig11537.1347.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig11537.1347.1 >prot_L-elsbetiae_contig11537.1347.1 ID=prot_L-elsbetiae_contig11537.1347.1|Name=mRNA_L-elsbetiae_contig11537.1347.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=84bp EYERELGFPQADGDNPPHGGERDPHGPAPRVRPRGQAAGRAAAQAPRRRPback to top mRNA from alignment at L-elsbetiae_contig11537:1357..2633- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig11537.1347.1 ID=mRNA_L-elsbetiae_contig11537.1347.1|Name=mRNA_L-elsbetiae_contig11537.1347.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=1277bp|location=Sequence derived from alignment at L-elsbetiae_contig11537:1357..2633- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig11537:1357..2633- >mRNA_L-elsbetiae_contig11537.1347.1 ID=mRNA_L-elsbetiae_contig11537.1347.1|Name=mRNA_L-elsbetiae_contig11537.1347.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=504bp|location=Sequence derived from alignment at L-elsbetiae_contig11537:1357..2633- (Laminarionema elsbetiae ELsaHSoW15)back to top |