mRNA_L-elsbetiae_contig11517.1331.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig11517.1331.1 vs. uniprot
Match: A0A6H5JRA9_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JRA9_9PHAE) HSP 1 Score: 74.7 bits (182), Expect = 8.560e-14 Identity = 38/77 (49.35%), Postives = 49/77 (63.64%), Query Frame = 1 Query: 1 AVVFSKGVLFLDDCDFSESTAPVLVLSKGQIPVIRNAVLGSGNYLEEGYMERKQEPTKRTRLRNAGPLINVNVTCDG 231 AVVF +G+L+LDDCDFS STA VLV S+ +RNAVLG NY + + + + A PL+NV+VTCDG Sbjct: 747 AVVFCEGILYLDDCDFSGSTASVLVQSEENFTTVRNAVLGDNNYFDVA-----KAASTANEIPTAEPLMNVDVTCDG 818
BLAST of mRNA_L-elsbetiae_contig11517.1331.1 vs. uniprot
Match: D7G0A8_ECTSI (Polymorphic outer membrane protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G0A8_ECTSI) HSP 1 Score: 72.0 bits (175), Expect = 7.540e-13 Identity = 40/78 (51.28%), Postives = 50/78 (64.10%), Query Frame = 1 Query: 1 AVVFSKGVLFLDDCDFSESTAPVLVLSKGQ-IPVIRNAVLGSGNYLEEGYMERKQEPTKRTRLRNAGPLINVNVTCDG 231 AVVFS+G L+LD+C+FS STA VLV S+G V+RNAVLG NY + + + + A LINVNVTCDG Sbjct: 309 AVVFSEGTLYLDECNFSGSTASVLVYSEGDSTTVVRNAVLGDNNYFDVA-----KAASTANEIPTAHSLINVNVTCDG 381
BLAST of mRNA_L-elsbetiae_contig11517.1331.1 vs. uniprot
Match: D7G0B0_ECTSI (Adhesin-like protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G0B0_ECTSI) HSP 1 Score: 71.2 bits (173), Expect = 1.420e-12 Identity = 42/80 (52.50%), Postives = 50/80 (62.50%), Query Frame = 1 Query: 1 AVVFSKGVLFLDDCDFSESTAPVLVLS-KGQIPVIRNAVLGSGNYLE--EGYMERKQEPTKRTRLRNAGPLINVNVTCDG 231 AVVFS+G+L+LDDCDFS S A VLV S + V+RNAVLG NY + E E PT + LI+VNVTCDG Sbjct: 659 AVVFSEGILYLDDCDFSGSAASVLVYSERNSTTVVRNAVLGDNNYFDVAEAASEAGDIPTAHS-------LISVNVTCDG 731
BLAST of mRNA_L-elsbetiae_contig11517.1331.1 vs. uniprot
Match: D7G5M2_ECTSI (Probable extracellular nuclease (ISS) n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G5M2_ECTSI) HSP 1 Score: 69.7 bits (169), Expect = 4.830e-12 Identity = 40/78 (51.28%), Postives = 50/78 (64.10%), Query Frame = 1 Query: 1 AVVFSKGVLFLDDCDFSESTAPVLVLSKGQIP-VIRNAVLGSGNYLEEGYMERKQEPTKRTRLRNAGPLINVNVTCDG 231 AVVFS+G L+LDDC+FS S+A VLV S+G V+RNAVLG NY + + + + A LINVNVTCDG Sbjct: 43 AVVFSEGTLYLDDCNFSGSSASVLVYSEGNSSTVVRNAVLGDYNYFDVA-----EAASTANVIPTAHSLINVNVTCDG 115
BLAST of mRNA_L-elsbetiae_contig11517.1331.1 vs. uniprot
Match: A0A6H5JH31_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JH31_9PHAE) HSP 1 Score: 54.3 bits (129), Expect = 1.120e-6 Identity = 27/43 (62.79%), Postives = 34/43 (79.07%), Query Frame = 1 Query: 4 VVFSKGVLFLDDCDFSESTAPVLVLSKGQI-PVIRNAVLGSGN 129 VVFS+G L+LD+C+FS STA VLV S+G + V+RNAVLG N Sbjct: 33 VVFSEGTLYLDECNFSGSTASVLVYSEGDLNTVVRNAVLGDNN 75 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig11517.1331.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 5
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig11517.1331.1 >prot_L-elsbetiae_contig11517.1331.1 ID=prot_L-elsbetiae_contig11517.1331.1|Name=mRNA_L-elsbetiae_contig11517.1331.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=83bp AVVFSKGVLFLDDCDFSESTAPVLVLSKGQIPVIRNAVLGSGNYLEEGYMback to top mRNA from alignment at L-elsbetiae_contig11517:842..1707- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig11517.1331.1 ID=mRNA_L-elsbetiae_contig11517.1331.1|Name=mRNA_L-elsbetiae_contig11517.1331.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=866bp|location=Sequence derived from alignment at L-elsbetiae_contig11517:842..1707- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig11517:842..1707- >mRNA_L-elsbetiae_contig11517.1331.1 ID=mRNA_L-elsbetiae_contig11517.1331.1|Name=mRNA_L-elsbetiae_contig11517.1331.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=498bp|location=Sequence derived from alignment at L-elsbetiae_contig11517:842..1707- (Laminarionema elsbetiae ELsaHSoW15)back to top |