mRNA_L-elsbetiae_contig11347.1186.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig11347.1186.1 vs. uniprot
Match: D7FWD4_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FWD4_ECTSI) HSP 1 Score: 64.3 bits (155), Expect = 3.710e-11 Identity = 34/46 (73.91%), Postives = 38/46 (82.61%), Query Frame = 1 Query: 1 LVACPSSPILSSPPPKVYILTTLNVLIEVNPQIRIPRTFKRFSGLM 138 L+A SP+ + +VYILTTLNVLIEVNPQIRIPRTFKRFSGLM Sbjct: 81 LLALLDSPLNKAGKLQVYILTTLNVLIEVNPQIRIPRTFKRFSGLM 126
BLAST of mRNA_L-elsbetiae_contig11347.1186.1 vs. uniprot
Match: A0A507C362_9FUNG (Uncharacterized protein n=1 Tax=Synchytrium microbalum TaxID=1806994 RepID=A0A507C362_9FUNG) HSP 1 Score: 58.5 bits (140), Expect = 5.810e-9 Identity = 30/48 (62.50%), Postives = 35/48 (72.92%), Query Frame = 1 Query: 10 CPSSPILSSPPPK-----VYILTTLNVLIEVNPQIRIPRTFKRFSGLM 138 C P+L SP K VY+ TT NVLIE+NPQ+RIPRTFKRF+GLM Sbjct: 91 CVEHPLLDSPLNKSGLLQVYVRTTKNVLIEINPQVRIPRTFKRFAGLM 138
BLAST of mRNA_L-elsbetiae_contig11347.1186.1 vs. uniprot
Match: A0A2T9Y1G7_9FUNG (Uncharacterized protein n=2 Tax=Harpellales TaxID=61421 RepID=A0A2T9Y1G7_9FUNG) HSP 1 Score: 57.8 bits (138), Expect = 1.490e-8 Identity = 26/31 (83.87%), Postives = 29/31 (93.55%), Query Frame = 1 Query: 46 KVYILTTLNVLIEVNPQIRIPRTFKRFSGLM 138 +VYI TT NVLIE+NPQ+RIPRTFKRFSGLM Sbjct: 173 QVYIRTTKNVLIEINPQVRIPRTFKRFSGLM 203
BLAST of mRNA_L-elsbetiae_contig11347.1186.1 vs. uniprot
Match: A0A1R1YCM5_9FUNG (Ribosomal RNA small subunit methyltransferase mra1 n=2 Tax=Smittium culicis TaxID=133412 RepID=A0A1R1YCM5_9FUNG) HSP 1 Score: 57.8 bits (138), Expect = 1.590e-8 Identity = 26/31 (83.87%), Postives = 29/31 (93.55%), Query Frame = 1 Query: 46 KVYILTTLNVLIEVNPQIRIPRTFKRFSGLM 138 +VYI TT NVLIE+NPQ+RIPRTFKRFSGLM Sbjct: 214 QVYIKTTKNVLIEINPQVRIPRTFKRFSGLM 244
BLAST of mRNA_L-elsbetiae_contig11347.1186.1 vs. uniprot
Match: A0A1R0H3G8_9FUNG (Ribosomal RNA small subunit methyltransferase mra1 n=1 Tax=Smittium mucronatum TaxID=133383 RepID=A0A1R0H3G8_9FUNG) HSP 1 Score: 57.8 bits (138), Expect = 1.610e-8 Identity = 26/31 (83.87%), Postives = 29/31 (93.55%), Query Frame = 1 Query: 46 KVYILTTLNVLIEVNPQIRIPRTFKRFSGLM 138 +VYI TT NVLIE+NPQ+RIPRTFKRFSGLM Sbjct: 233 QVYIRTTKNVLIEINPQVRIPRTFKRFSGLM 263
BLAST of mRNA_L-elsbetiae_contig11347.1186.1 vs. uniprot
Match: A0A6V1NKS5_HETAK (Hypothetical protein n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A6V1NKS5_HETAK) HSP 1 Score: 56.2 bits (134), Expect = 3.450e-8 Identity = 30/46 (65.22%), Postives = 35/46 (76.09%), Query Frame = 1 Query: 1 LVACPSSPILSSPPPKVYILTTLNVLIEVNPQIRIPRTFKRFSGLM 138 L+A SP+ + KVYI TT NVLI+VNP IRIPRTFKRF+GLM Sbjct: 68 LLALLDSPLNKAGKLKVYINTTKNVLIDVNPAIRIPRTFKRFAGLM 113
BLAST of mRNA_L-elsbetiae_contig11347.1186.1 vs. uniprot
Match: NEP1_CANGA (Ribosomal RNA small subunit methyltransferase NEP1 n=5 Tax=Nakaseomyces TaxID=374468 RepID=NEP1_CANGA) HSP 1 Score: 56.2 bits (134), Expect = 3.570e-8 Identity = 26/31 (83.87%), Postives = 28/31 (90.32%), Query Frame = 1 Query: 46 KVYILTTLNVLIEVNPQIRIPRTFKRFSGLM 138 +VYILT NVLIEVNP +RIPRTFKRFSGLM Sbjct: 90 QVYILTKKNVLIEVNPSVRIPRTFKRFSGLM 120
BLAST of mRNA_L-elsbetiae_contig11347.1186.1 vs. uniprot
Match: A0A507E013_9FUNG (Uncharacterized protein n=1 Tax=Powellomyces hirtus TaxID=109895 RepID=A0A507E013_9FUNG) HSP 1 Score: 56.2 bits (134), Expect = 3.650e-8 Identity = 26/31 (83.87%), Postives = 28/31 (90.32%), Query Frame = 1 Query: 46 KVYILTTLNVLIEVNPQIRIPRTFKRFSGLM 138 +VYI TT NVLIEVNP +RIPRTFKRFSGLM Sbjct: 91 QVYIQTTKNVLIEVNPHVRIPRTFKRFSGLM 121
BLAST of mRNA_L-elsbetiae_contig11347.1186.1 vs. uniprot
Match: A0A397TNS9_9GLOM (Alpha/beta knot methyltransferase n=1 Tax=Glomus cerebriforme TaxID=658196 RepID=A0A397TNS9_9GLOM) HSP 1 Score: 56.6 bits (135), Expect = 3.960e-8 Identity = 30/46 (65.22%), Postives = 35/46 (76.09%), Query Frame = 1 Query: 1 LVACPSSPILSSPPPKVYILTTLNVLIEVNPQIRIPRTFKRFSGLM 138 L+A SP+ + +VYI TT NVLIEVNP +RIPRTFKRFSGLM Sbjct: 172 LMALLDSPLNKAGLMQVYIHTTKNVLIEVNPHVRIPRTFKRFSGLM 217
BLAST of mRNA_L-elsbetiae_contig11347.1186.1 vs. uniprot
Match: T1H111_MEGSC (Uncharacterized protein n=1 Tax=Megaselia scalaris TaxID=36166 RepID=T1H111_MEGSC) HSP 1 Score: 54.7 bits (130), Expect = 5.280e-8 Identity = 25/31 (80.65%), Postives = 28/31 (90.32%), Query Frame = 1 Query: 46 KVYILTTLNVLIEVNPQIRIPRTFKRFSGLM 138 +VYI T NVLIE+NPQIRIPRTFKRF+GLM Sbjct: 14 QVYIKTEKNVLIEINPQIRIPRTFKRFAGLM 44 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig11347.1186.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig11347.1186.1 >prot_L-elsbetiae_contig11347.1186.1 ID=prot_L-elsbetiae_contig11347.1186.1|Name=mRNA_L-elsbetiae_contig11347.1186.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=46bp LVACPSSPILSSPPPKVYILTTLNVLIEVNPQIRIPRTFKRFSGLMback to top mRNA from alignment at L-elsbetiae_contig11347:6027..6164+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig11347.1186.1 ID=mRNA_L-elsbetiae_contig11347.1186.1|Name=mRNA_L-elsbetiae_contig11347.1186.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=138bp|location=Sequence derived from alignment at L-elsbetiae_contig11347:6027..6164+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig11347:6027..6164+ >mRNA_L-elsbetiae_contig11347.1186.1 ID=mRNA_L-elsbetiae_contig11347.1186.1|Name=mRNA_L-elsbetiae_contig11347.1186.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=276bp|location=Sequence derived from alignment at L-elsbetiae_contig11347:6027..6164+ (Laminarionema elsbetiae ELsaHSoW15)back to top |