mRNA_L-elsbetiae_contig11330.1177.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig11330.1177.1 vs. uniprot
Match: D8LCI2_ECTSI (EsV-1-7 n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LCI2_ECTSI) HSP 1 Score: 88.2 bits (217), Expect = 2.660e-17 Identity = 38/42 (90.48%), Postives = 39/42 (92.86%), Query Frame = 1 Query: 1 MPTWRCGHPGCDKHSSYGVKGSKEREFCGRHAKDGMVDVRSK 126 M TWRCGHPGC KHSSYGVKG+KEREFCGRHAK GMVDVRSK Sbjct: 1 MVTWRCGHPGCGKHSSYGVKGTKEREFCGRHAKMGMVDVRSK 42
BLAST of mRNA_L-elsbetiae_contig11330.1177.1 vs. uniprot
Match: D7FI73_ECTSI (EsV-1-7 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FI73_ECTSI) HSP 1 Score: 58.2 bits (139), Expect = 2.960e-6 Identity = 23/38 (60.53%), Postives = 30/38 (78.95%), Query Frame = 1 Query: 13 RCGHPGCDKHSSYGVKGSKEREFCGRHAKDGMVDVRSK 126 +CGH C K +YGV GSK+REFC +HA+DGMV+V +K Sbjct: 3 QCGHANCTKRPTYGVAGSKKREFCSQHARDGMVNVNNK 40
BLAST of mRNA_L-elsbetiae_contig11330.1177.1 vs. uniprot
Match: A0A6H5JT00_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JT00_9PHAE) HSP 1 Score: 58.2 bits (139), Expect = 3.530e-6 Identity = 23/38 (60.53%), Postives = 30/38 (78.95%), Query Frame = 1 Query: 13 RCGHPGCDKHSSYGVKGSKEREFCGRHAKDGMVDVRSK 126 +CGH C K +YGV GSK+REFC +HA+DGMV+V +K Sbjct: 63 QCGHENCTKRPTYGVAGSKKREFCSQHARDGMVNVNNK 100 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig11330.1177.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig11330.1177.1 >prot_L-elsbetiae_contig11330.1177.1 ID=prot_L-elsbetiae_contig11330.1177.1|Name=mRNA_L-elsbetiae_contig11330.1177.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=248bp MPTWRCGHPGCDKHSSYGVKGSKEREFCGRHAKDGMVDVRSKRCGQEGCEback to top mRNA from alignment at L-elsbetiae_contig11330:1954..2697- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig11330.1177.1 ID=mRNA_L-elsbetiae_contig11330.1177.1|Name=mRNA_L-elsbetiae_contig11330.1177.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=744bp|location=Sequence derived from alignment at L-elsbetiae_contig11330:1954..2697- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig11330:1954..2697- >mRNA_L-elsbetiae_contig11330.1177.1 ID=mRNA_L-elsbetiae_contig11330.1177.1|Name=mRNA_L-elsbetiae_contig11330.1177.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=1488bp|location=Sequence derived from alignment at L-elsbetiae_contig11330:1954..2697- (Laminarionema elsbetiae ELsaHSoW15)back to top |