prot_H-elongata_contig17001.4340.1 (polypeptide) Himanthalia elongata Himel1 dioecious

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview


Name	mRNA_H-elongata_contig17001.4340.1
Unique Name	prot_H-elongata_contig17001.4340.1
Type	polypeptide
Organism	Himanthalia elongata Himel1 dioecious (Himanthalia elongata Himel1 dioecious)
Sequence length	251

Homology

[Close]

BLAST of mRNA_H-elongata_contig17001.4340.1 vs. uniprot
Match: D7FVC1_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FVC1_ECTSI)

HSP 1 Score: 174 bits (441), Expect = 1.390e-49
Identity = 89/185 (48.11%), Postives = 128/185 (69.19%), Query Frame = 0

Query:   66 LVALVGAIRPWTTQKALLAMVTLAAILRIAWTIVAILTWNAALGVVSMDVHKSLHVVFYGLDYFQAAAAFTLYTILARFWAELAYAARHGSPPARTDRGSGSGRADQYRPVGTPVLLWNVTRAVQHAASTMAFVFAAFATLLQATIWARDPTYVDEWTGFIEAGAYVLASVVMITTAYCAIIELR 250
            ++A++ A RP+TTQKALL+M+TL+A L IAW+++A   W+   G + + V  +L V FYG D+F AA  FTLYTILA+FWA+LA++AR G+  +R       G  D+YRP GTP L+W +TR VQ  +ST+ F  AA AT+ QA +   D  Y++ WT ++E G ++LA+ VM+T AY A++ELR
Sbjct:    5 VMAMLAAFRPFTTQKALLSMLTLSAALSIAWSVLAYEAWDLLHGTLDVSVSVALRVAFYGTDFFLAATTFTLYTILAKFWADLAFSARQGAGASRP-----LGGGDEYRPRGTPTLIWKITRGVQRVSSTVVFAAAALATVFQAVLVTLDSMYLNLWTAYVEGGVFILAAFVMVTAAYYAVVELR 184

The following BLAST results are available for this feature:

BLAST of mRNA_H-elongata_contig17001.4340.1 vs. uniprot

BLAST of mRNA_H-elongata_contig17001.4340.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 1


Match Name	E-value	Identity	Description
D7FVC1_ECTSI	1.390e-49	48.11	Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2...	[more]

InterPro

Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
None	No IPR available	PHOBIUS	CYTOPLASMIC_DOMAIN	Cytoplasmic domain	coord: 147..191
None	No IPR available	PHOBIUS	NON_CYTOPLASMIC_DOMAIN	Non cytoplasmic domain	coord: 109..127
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 6..31
None	No IPR available	PHOBIUS	CYTOPLASMIC_DOMAIN	Cytoplasmic domain	coord: 247..250
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 192..213
None	No IPR available	PHOBIUS	NON_CYTOPLASMIC_DOMAIN	Non cytoplasmic domain	coord: 214..224
None	No IPR available	PHOBIUS	NON_CYTOPLASMIC_DOMAIN	Non cytoplasmic domain	coord: 1..5
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 82..108
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 225..246
None	No IPR available	PHOBIUS	CYTOPLASMIC_DOMAIN	Cytoplasmic domain	coord: 32..81
None	No IPR available	PHOBIUS	TRANSMEMBRANE	Transmembrane region	coord: 128..146
None	No IPR available	TMHMM	TMhelix		coord: 82..104
None	No IPR available	TMHMM	TMhelix		coord: 228..247
None	No IPR available	TMHMM	TMhelix		coord: 10..32
None	No IPR available	TMHMM	TMhelix		coord: 191..213
None	No IPR available	TMHMM	TMhelix		coord: 119..141

Alignments

The following features are aligned


Aligned Feature	Feature Type	Alignment Location
H-elongata_contig17001	contig	H-elongata_contig17001:3018..5944 -

Analyses

This polypeptide is derived from or has results from the following analyses


Analysis Name	Date Performed
InterProScan on OGS1.0	2022-09-29
Diamond blastp: OGS1.0 vs UniRef90	2022-09-16
OGS1.0 of Himanthalia elongata Himel1 dioecious	2021-02-24

Relationships

This polypeptide derives from the following mRNA feature(s):


Feature Name	Unique Name	Species	Type	Position
mRNA_H-elongata_contig17001.4340.1	mRNA_H-elongata_contig17001.4340.1	Himanthalia elongata Himel1 dioecious	mRNA	H-elongata_contig17001 1998..5969 -

Sequences

The following sequences are available for this feature:

polypeptide sequence

polypeptide sequence

>prot_H-elongata_contig17001.4340.1 ID=prot_H-elongata_contig17001.4340.1|Name=mRNA_H-elongata_contig17001.4340.1|organism=Himanthalia elongata Himel1 dioecious|type=polypeptide|length=251bp
MVTARLWLLAMVILVVAINGCLLFTSGLALLRVLRAAARDAYSSPRRRLL
ALDDGGAARRGSGGGLVALVGAIRPWTTQKALLAMVTLAAILRIAWTIVA
ILTWNAALGVVSMDVHKSLHVVFYGLDYFQAAAAFTLYTILARFWAELAY
AARHGSPPARTDRGSGSGRADQYRPVGTPVLLWNVTRAVQHAASTMAFVF
AAFATLLQATIWARDPTYVDEWTGFIEAGAYVLASVVMITTAYCAIIELR
*