prot_H-elongata_contig52221.12523.1 (polypeptide) Himanthalia elongata Himel1 dioecious

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NamemRNA_H-elongata_contig52221.12523.1
Unique Nameprot_H-elongata_contig52221.12523.1
Typepolypeptide
OrganismHimanthalia elongata Himel1 dioecious (Himanthalia elongata Himel1 dioecious)
Sequence length284
Homology
The following BLAST results are available for this feature:
BLAST of mRNA_H-elongata_contig52221.12523.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003409MORN motifSMARTSM00698morncoord: 221..242
e-value: 7.4E-6
score: 35.5
coord: 14..35
e-value: 9.0E-4
score: 28.5
coord: 129..150
e-value: 0.11
score: 21.2
coord: 106..127
e-value: 0.49
score: 16.4
coord: 152..173
e-value: 0.011
score: 24.9
coord: 37..58
e-value: 1.5
score: 12.7
coord: 175..196
e-value: 0.0045
score: 26.2
coord: 244..265
e-value: 0.75
score: 15.0
coord: 198..219
e-value: 0.91
score: 14.4
coord: 60..81
e-value: 0.26
score: 18.5
coord: 83..104
e-value: 5.0E-7
score: 39.4
IPR003409MORN motifPFAMPF02493MORNcoord: 85..107
e-value: 2.6E-8
score: 33.3
coord: 154..175
e-value: 2.9E-4
score: 20.5
coord: 16..38
e-value: 1.9E-5
score: 24.3
coord: 246..262
e-value: 0.018
score: 14.9
coord: 108..129
e-value: 0.0081
score: 16.0
coord: 1..15
e-value: 0.074
score: 13.0
coord: 223..243
e-value: 6.9E-6
score: 25.6
coord: 132..153
e-value: 5.0E-6
score: 26.1
coord: 201..221
e-value: 0.0098
score: 15.7
coord: 177..199
e-value: 7.4E-4
score: 19.3
coord: 39..56
e-value: 5.1
score: 7.2
coord: 63..84
e-value: 9.6E-5
score: 22.1
NoneNo IPR availableGENE3D2.20.110.10coord: 1..63
e-value: 8.2E-8
score: 34.2
coord: 205..281
e-value: 1.5E-13
score: 52.8
coord: 64..135
e-value: 9.3E-14
score: 53.5
coord: 136..204
e-value: 1.2E-14
score: 56.3
NoneNo IPR availablePANTHERPTHR46511FAMILY NOT NAMEDcoord: 131..217
coord: 4..98
coord: 85..184
coord: 67..148
coord: 176..262
NoneNo IPR availableSUPERFAMILY82185Histone H3 K4-specific methyltransferase SET7/9 N-terminal domaincoord: 79..190
NoneNo IPR availableSUPERFAMILY82185Histone H3 K4-specific methyltransferase SET7/9 N-terminal domaincoord: 172..278
NoneNo IPR availableSUPERFAMILY82185Histone H3 K4-specific methyltransferase SET7/9 N-terminal domaincoord: 1..92

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
H-elongata_contig52221contigH-elongata_contig52221:135..3473 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan on OGS1.02022-09-29
Diamond blastp: OGS1.0 vs UniRef902022-09-16
OGS1.0 of Himanthalia elongata Himel1 dioecious2021-02-24
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
mRNA_H-elongata_contig52221.12523.1mRNA_H-elongata_contig52221.12523.1Himanthalia elongata Himel1 dioeciousmRNAH-elongata_contig52221 105..3473 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>prot_H-elongata_contig52221.12523.1 ID=prot_H-elongata_contig52221.12523.1|Name=mRNA_H-elongata_contig52221.12523.1|organism=Himanthalia elongata Himel1 dioecious|type=polypeptide|length=284bp
MMHGKGTFMWSKGDMYDGDWRAGKMHGHGVKKMGNGDVYEGAWKGGMADG
WGKKKFRCGDLHEGCYKEDKRCGFGIYMWVNGDRYEGEWRNGRMHGKGVK
VMANGDVYNGTWENDKAEGNGVKVFACGDRHEGDYHEDKRHGYGCYTWDS
GDRYEGYWAEGRMSGKGVKYMANGDIYDGEWHDDKAHGWGMKAFANGDRH
EGEYCLDLRQGSGMYHWANGDCYEGDWERGEQSGSGTYTYANQAVYDGVW
ENGRKHGSGYFSSGSQLLLELWCRGVRVKRCEVS
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR003409MORN