prot_H-elongata_contig100166.19.1 (polypeptide) Himanthalia elongata Himel1 dioecious
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_H-elongata_contig100166.19.1 vs. uniprot
Match: D7G200_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G200_ECTSI) HSP 1 Score: 110 bits (275), Expect = 7.530e-27 Identity = 51/65 (78.46%), Postives = 59/65 (90.77%), Query Frame = 0 Query: 8 TPSSSMSLVFGYSVHVGCMKSVAMTTSGTRAGQLLVTGGADEHIRIYDLRDKRELGELQQHDGTV 72 TP +SLVFGY+VHVGCMKSVA+ TSG+RAGQLLVTGGADE +RIYDLRD+ ELGELQQH+GT+ Sbjct: 60 TPPQPLSLVFGYNVHVGCMKSVAIATSGSRAGQLLVTGGADERVRIYDLRDRTELGELQQHNGTI 124
BLAST of mRNA_H-elongata_contig100166.19.1 vs. uniprot
Match: A0A836CGS2_9STRA (WD40-repeat-containing domain protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CGS2_9STRA) HSP 1 Score: 85.1 bits (209), Expect = 1.160e-17 Identity = 40/67 (59.70%), Postives = 50/67 (74.63%), Query Frame = 0 Query: 6 ATTPSSSMSLVFGYSVHVGCMKSVAMTTSGTRAGQLLVTGGADEHIRIYDLRDKRELGELQQHDGTV 72 AT P + +S+ +GY VH GC+KS+A+ GT AG++LVTGG DE IRIYDL + E GELQQH GTV Sbjct: 22 ATAPDT-LSMAYGYKVHAGCVKSLAIAEKGTLAGKMLVTGGTDERIRIYDLGQRTEKGELQQHSGTV 87
BLAST of mRNA_H-elongata_contig100166.19.1 vs. uniprot
Match: A0A7R9Y9Y4_9STRA (Hypothetical protein n=1 Tax=Pinguiococcus pyrenoidosus TaxID=172671 RepID=A0A7R9Y9Y4_9STRA) HSP 1 Score: 77.8 bits (190), Expect = 1.430e-15 Identity = 36/62 (58.06%), Postives = 45/62 (72.58%), Query Frame = 0 Query: 11 SSMSLVFGYSVHVGCMKSVAMTTSGTRAGQLLVTGGADEHIRIYDLRDKRELGELQQHDGTV 72 S + L F Y H+GC+KS+A+ T+ R G LLV+GG DE IRIYDL K E+GELQQH+G V Sbjct: 38 SPLQLSFAYRAHIGCIKSLALCTTQKRGGALLVSGGTDERIRIYDLALKAEVGELQQHNGAV 99
BLAST of mRNA_H-elongata_contig100166.19.1 vs. uniprot
Match: A0A7R9U2R5_9STRA (Hypothetical protein n=1 Tax=Pinguiococcus pyrenoidosus TaxID=172671 RepID=A0A7R9U2R5_9STRA) HSP 1 Score: 77.8 bits (190), Expect = 3.200e-15 Identity = 36/62 (58.06%), Postives = 45/62 (72.58%), Query Frame = 0 Query: 11 SSMSLVFGYSVHVGCMKSVAMTTSGTRAGQLLVTGGADEHIRIYDLRDKRELGELQQHDGTV 72 S + L F Y H+GC+KS+A+ T+ R G LLV+GG DE IRIYDL K E+GELQQH+G V Sbjct: 38 SPLQLSFAYRAHIGCIKSLALCTTQKRGGALLVSGGTDERIRIYDLALKAEVGELQQHNGAV 99
BLAST of mRNA_H-elongata_contig100166.19.1 vs. uniprot
Match: K8ZAK0_NANGC (Uncharacterized protein n=2 Tax=Monodopsidaceae TaxID=425072 RepID=K8ZAK0_NANGC) HSP 1 Score: 73.2 bits (178), Expect = 1.780e-13 Identity = 30/60 (50.00%), Postives = 44/60 (73.33%), Query Frame = 0 Query: 13 MSLVFGYSVHVGCMKSVAMTTSGTRAGQLLVTGGADEHIRIYDLRDKRELGELQQHDGTV 72 + ++F Y+ H G ++S+A+ G +AG LLV+GG DEHIR+YDLR + E+GEL H GT+ Sbjct: 53 LKMIFAYTPHQGSVRSLAIPQGGVKAGSLLVSGGVDEHIRMYDLRKRAEVGELLHHKGTI 112
BLAST of mRNA_H-elongata_contig100166.19.1 vs. uniprot
Match: A0A7S3YLB8_HETAK (Hypothetical protein (Fragment) n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3YLB8_HETAK) HSP 1 Score: 68.6 bits (166), Expect = 2.720e-13 Identity = 32/62 (51.61%), Postives = 43/62 (69.35%), Query Frame = 0 Query: 11 SSMSLVFGYSVHVGCMKSVAMTTSGTRAGQLLVTGGADEHIRIYDLRDKRELGELQQHDGTV 72 S + L + H G +K +++T +G + G++LVTGG DE IRIYDL K ELGELQQH GT+ Sbjct: 14 SDVQLSYALHAHEGSVKCLSITQTGAKQGRILVTGGNDELIRIYDLSKKVELGELQQHSGTI 75
BLAST of mRNA_H-elongata_contig100166.19.1 vs. uniprot
Match: W7TL70_9STRA (Pak1ip1 protein n=1 Tax=Nannochloropsis gaditana TaxID=72520 RepID=W7TL70_9STRA) HSP 1 Score: 72.4 bits (176), Expect = 3.270e-13 Identity = 31/59 (52.54%), Postives = 43/59 (72.88%), Query Frame = 0 Query: 14 SLVFGYSVHVGCMKSVAMTTSGTRAGQLLVTGGADEHIRIYDLRDKRELGELQQHDGTV 72 S +F Y+ H G ++S+A+ G +AG LLV+GG DEHIR+YDLR + E+GEL H GT+ Sbjct: 37 SQIFAYTPHQGSVRSLAIPQGGVKAGSLLVSGGVDEHIRMYDLRKRAEVGELLHHKGTI 95
BLAST of mRNA_H-elongata_contig100166.19.1 vs. uniprot
Match: A0A0C2X428_9AGAM (Uncharacterized protein n=1 Tax=Serendipita vermifera MAFF 305830 TaxID=933852 RepID=A0A0C2X428_9AGAM) HSP 1 Score: 63.2 bits (152), Expect = 6.060e-10 Identity = 30/72 (41.67%), Postives = 45/72 (62.50%), Query Frame = 0 Query: 1 QPVATATTPSSSMSLVFGYSVHVGCMKSVAMTTSGTRAGQLLVTGGADEHIRIYDLRDKRELGELQQHDGTV 72 +P T +S +F + H+ C+K+VA + G G+ L +GG DE I+++DLR K+ELG LQQH G+V Sbjct: 88 EPTGRETGQTSEFKPIFVFPAHISCVKAVAASPQG---GKWLASGGTDEIIKVWDLRRKKELGSLQQHQGSV 156
BLAST of mRNA_H-elongata_contig100166.19.1 vs. uniprot
Match: G4TBN7_SERID (Related to MAK11 protein (Maintenance of killer toxin-encoding satellite M1 dsRNA) n=1 Tax=Serendipita indica (strain DSM 11827) TaxID=1109443 RepID=G4TBN7_SERID) HSP 1 Score: 60.1 bits (144), Expect = 7.400e-9 Identity = 27/57 (47.37%), Postives = 39/57 (68.42%), Query Frame = 0 Query: 16 VFGYSVHVGCMKSVAMTTSGTRAGQLLVTGGADEHIRIYDLRDKRELGELQQHDGTV 72 VF + H+ C+K+VA + G G+ L TG DE I+I+DLR ++ELG LQQH G++ Sbjct: 106 VFCFPAHISCVKAVAASPQG---GKWLATGATDETIKIWDLRRRKELGSLQQHQGSI 159
BLAST of mRNA_H-elongata_contig100166.19.1 vs. uniprot
Match: A0A2G8RTK2_9APHY (Transporter n=1 Tax=Ganoderma sinense ZZ0214-1 TaxID=1077348 RepID=A0A2G8RTK2_9APHY) HSP 1 Score: 59.7 bits (143), Expect = 1.020e-8 Identity = 27/57 (47.37%), Postives = 40/57 (70.18%), Query Frame = 0 Query: 16 VFGYSVHVGCMKSVAMTTSGTRAGQLLVTGGADEHIRIYDLRDKRELGELQQHDGTV 72 +F + HV C+KSVA++ G G+ L TG ADE I+++DLR ++ELG L QH G++ Sbjct: 126 IFIFPAHVSCIKSVAVSPQG---GKWLATGSADEIIKVWDLRRRKELGGLMQHQGSI 179 The following BLAST results are available for this feature:
BLAST of mRNA_H-elongata_contig100166.19.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-elongata_contig100166.19.1 ID=prot_H-elongata_contig100166.19.1|Name=mRNA_H-elongata_contig100166.19.1|organism=Himanthalia elongata Himel1 dioecious|type=polypeptide|length=72bpback to top |