mRNA_H-elongata_contig103845.325.1 (mRNA) Himanthalia elongata Himel1 dioecious
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_H-elongata_contig103845.325.1 vs. uniprot
Match: A0A2P4YHC9_9STRA (Splicing factor 3B subunit 1 n=1 Tax=Phytophthora palmivora var. palmivora TaxID=611791 RepID=A0A2P4YHC9_9STRA) HSP 1 Score: 100 bits (250), Expect = 1.110e-25 Identity = 46/49 (93.88%), Postives = 48/49 (97.96%), Query Frame = 1 Query: 1 TACTTVKHLSLGVAMLGCEDALVHLLNFVWPNIFETSPHVINAVFEAIE 147 TACTTVKHL+LGVA LGCEDALVHLLNFVWPNIFETSPHVINAVFEA+E Sbjct: 55 TACTTVKHLALGVAGLGCEDALVHLLNFVWPNIFETSPHVINAVFEAVE 103
BLAST of mRNA_H-elongata_contig103845.325.1 vs. uniprot
Match: D7FI13_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FI13_ECTSI) HSP 1 Score: 105 bits (262), Expect = 3.180e-25 Identity = 49/49 (100.00%), Postives = 49/49 (100.00%), Query Frame = 1 Query: 1 TACTTVKHLSLGVAMLGCEDALVHLLNFVWPNIFETSPHVINAVFEAIE 147 TACTTVKHLSLGVAMLGCEDALVHLLNFVWPNIFETSPHVINAVFEAIE Sbjct: 442 TACTTVKHLSLGVAMLGCEDALVHLLNFVWPNIFETSPHVINAVFEAIE 490
BLAST of mRNA_H-elongata_contig103845.325.1 vs. uniprot
Match: A0A6H5JJ74_9PHAE (TOG domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JJ74_9PHAE) HSP 1 Score: 105 bits (262), Expect = 3.710e-25 Identity = 49/49 (100.00%), Postives = 49/49 (100.00%), Query Frame = 1 Query: 1 TACTTVKHLSLGVAMLGCEDALVHLLNFVWPNIFETSPHVINAVFEAIE 147 TACTTVKHLSLGVAMLGCEDALVHLLNFVWPNIFETSPHVINAVFEAIE Sbjct: 1259 TACTTVKHLSLGVAMLGCEDALVHLLNFVWPNIFETSPHVINAVFEAIE 1307
BLAST of mRNA_H-elongata_contig103845.325.1 vs. uniprot
Match: A0A5D6XVH6_9STRA (SF3b1 domain-containing protein n=1 Tax=Pythium brassicum TaxID=1485010 RepID=A0A5D6XVH6_9STRA) HSP 1 Score: 101 bits (251), Expect = 1.140e-23 Identity = 47/49 (95.92%), Postives = 48/49 (97.96%), Query Frame = 1 Query: 1 TACTTVKHLSLGVAMLGCEDALVHLLNFVWPNIFETSPHVINAVFEAIE 147 TACTTVKHL+LGVA LGCEDALVHLLNFVWPNIFETSPHVINAVFEAIE Sbjct: 1153 TACTTVKHLALGVAGLGCEDALVHLLNFVWPNIFETSPHVINAVFEAIE 1201
BLAST of mRNA_H-elongata_contig103845.325.1 vs. uniprot
Match: K3WVF4_GLOUD (SF3b1 domain-containing protein n=1 Tax=Globisporangium ultimum (strain ATCC 200006 / CBS 805.95 / DAOM BR144) TaxID=431595 RepID=K3WVF4_GLOUD) HSP 1 Score: 99.4 bits (246), Expect = 5.410e-23 Identity = 45/49 (91.84%), Postives = 48/49 (97.96%), Query Frame = 1 Query: 1 TACTTVKHLSLGVAMLGCEDALVHLLNFVWPNIFETSPHVINAVFEAIE 147 TACTTVKH++LGVA LGCEDALVHLLN+VWPNIFETSPHVINAVFEAIE Sbjct: 1137 TACTTVKHIALGVAGLGCEDALVHLLNYVWPNIFETSPHVINAVFEAIE 1185
BLAST of mRNA_H-elongata_contig103845.325.1 vs. uniprot
Match: M4BK12_HYAAE (INTEIN_C_TER domain-containing protein n=3 Tax=Peronosporaceae TaxID=4777 RepID=M4BK12_HYAAE) HSP 1 Score: 99.4 bits (246), Expect = 5.410e-23 Identity = 45/49 (91.84%), Postives = 47/49 (95.92%), Query Frame = 1 Query: 1 TACTTVKHLSLGVAMLGCEDALVHLLNFVWPNIFETSPHVINAVFEAIE 147 TACTTVKHL+LGV LGCEDALVHLLNFVWPNIFETSPHVINAVFEA+E Sbjct: 1292 TACTTVKHLALGVTGLGCEDALVHLLNFVWPNIFETSPHVINAVFEAVE 1340
BLAST of mRNA_H-elongata_contig103845.325.1 vs. uniprot
Match: H3G976_PHYRM (SF3b1 domain-containing protein n=20 Tax=Peronosporaceae TaxID=4777 RepID=H3G976_PHYRM) HSP 1 Score: 98.6 bits (244), Expect = 1.010e-22 Identity = 44/49 (89.80%), Postives = 48/49 (97.96%), Query Frame = 1 Query: 1 TACTTVKHLSLGVAMLGCEDALVHLLNFVWPNIFETSPHVINAVFEAIE 147 TACTTVKHL+LGVA LGCEDAL+HLLNFVWPNIFETSPHVINAV+EA+E Sbjct: 1112 TACTTVKHLALGVAGLGCEDALLHLLNFVWPNIFETSPHVINAVYEAVE 1160
BLAST of mRNA_H-elongata_contig103845.325.1 vs. uniprot
Match: G5A4J4_PHYSP (Uncharacterized protein n=2 Tax=Phytophthora TaxID=4783 RepID=G5A4J4_PHYSP) HSP 1 Score: 98.2 bits (243), Expect = 1.380e-22 Identity = 44/49 (89.80%), Postives = 47/49 (95.92%), Query Frame = 1 Query: 1 TACTTVKHLSLGVAMLGCEDALVHLLNFVWPNIFETSPHVINAVFEAIE 147 TACTTVKHL+LGV LGCEDAL+HLLNFVWPNIFETSPHVINAVFEA+E Sbjct: 748 TACTTVKHLALGVVGLGCEDALLHLLNFVWPNIFETSPHVINAVFEAVE 796
BLAST of mRNA_H-elongata_contig103845.325.1 vs. uniprot
Match: A0A024G627_9STRA (SF3b1 domain-containing protein n=1 Tax=Albugo candida TaxID=65357 RepID=A0A024G627_9STRA) HSP 1 Score: 97.4 bits (241), Expect = 2.570e-22 Identity = 46/53 (86.79%), Postives = 50/53 (94.34%), Query Frame = 1 Query: 1 TACTTVKHLSLGVAMLGCEDALVHLLNFVWPNIFETSPHVINAVFEAIEVLCR 159 TACTTVKH++LGVA LGCEDALVHLLN+VWPNIFETSPHVINAVF+AI V CR Sbjct: 1124 TACTTVKHIALGVAGLGCEDALVHLLNYVWPNIFETSPHVINAVFDAI-VGCR 1175
BLAST of mRNA_H-elongata_contig103845.325.1 vs. uniprot
Match: F0W6T1_9STRA (Uncharacterized protein AlNc14C26G2567 n=1 Tax=Albugo laibachii Nc14 TaxID=890382 RepID=F0W6T1_9STRA) HSP 1 Score: 97.1 bits (240), Expect = 3.500e-22 Identity = 45/53 (84.91%), Postives = 50/53 (94.34%), Query Frame = 1 Query: 1 TACTTVKHLSLGVAMLGCEDALVHLLNFVWPNIFETSPHVINAVFEAIEVLCR 159 TACTTVKH++LGVA LGCEDALVHLLN+VWPNIFETSPHVINAVF+A+ V CR Sbjct: 1120 TACTTVKHIALGVAGLGCEDALVHLLNYVWPNIFETSPHVINAVFDAV-VGCR 1171 The following BLAST results are available for this feature:
BLAST of mRNA_H-elongata_contig103845.325.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-elongata_contig103845.325.1 >prot_H-elongata_contig103845.325.1 ID=prot_H-elongata_contig103845.325.1|Name=mRNA_H-elongata_contig103845.325.1|organism=Himanthalia elongata Himel1 dioecious|type=polypeptide|length=54bp TACTTVKHLSLGVAMLGCEDALVHLLNFVWPNIFETSPHVINAVFEAIEVback to top mRNA from alignment at H-elongata_contig103845:756..917- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-elongata_contig103845.325.1 ID=mRNA_H-elongata_contig103845.325.1|Name=mRNA_H-elongata_contig103845.325.1|organism=Himanthalia elongata Himel1 dioecious|type=mRNA|length=162bp|location=Sequence derived from alignment at H-elongata_contig103845:756..917- (Himanthalia elongata Himel1 dioecious)back to top Coding sequence (CDS) from alignment at H-elongata_contig103845:756..917- >mRNA_H-elongata_contig103845.325.1 ID=mRNA_H-elongata_contig103845.325.1|Name=mRNA_H-elongata_contig103845.325.1|organism=Himanthalia elongata Himel1 dioecious|type=CDS|length=324bp|location=Sequence derived from alignment at H-elongata_contig103845:756..917- (Himanthalia elongata Himel1 dioecious)back to top |