mRNA_H-elongata_contig103461.288.1 (mRNA) Himanthalia elongata Himel1 dioecious
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_H-elongata_contig103461.288.1 vs. uniprot
Match: D8LDE8_ECTSI (RNA pseudouridylate synthase domain-containing protein (C-terminal) RNA pseudouridylate synthase dom n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LDE8_ECTSI) HSP 1 Score: 89.0 bits (219), Expect = 2.390e-19 Identity = 40/52 (76.92%), Postives = 47/52 (90.38%), Query Frame = 1 Query: 1 NRQIRKICKYLCLKVSRLARVRFGPFSLGKVRPGGVSRVQIPDSFLRRLEEG 156 NRQIRKICKYLCL V+RLAR R+GPFSLGKVR GGV+ V+IP +F+RRLE+G Sbjct: 324 NRQIRKICKYLCLTVNRLARTRYGPFSLGKVRAGGVAAVEIPKAFMRRLEDG 375
BLAST of mRNA_H-elongata_contig103461.288.1 vs. uniprot
Match: A0A6H5J790_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5J790_9PHAE) HSP 1 Score: 77.0 bits (188), Expect = 4.690e-16 Identity = 34/47 (72.34%), Postives = 41/47 (87.23%), Query Frame = 1 Query: 16 KICKYLCLKVSRLARVRFGPFSLGKVRPGGVSRVQIPDSFLRRLEEG 156 KICKYLCL V+RLAR +GPFSLGKVR GGV+ V+IP +F+RRLE+G Sbjct: 42 KICKYLCLTVNRLARTGYGPFSLGKVRAGGVAAVEIPKAFMRRLEDG 88
BLAST of mRNA_H-elongata_contig103461.288.1 vs. uniprot
Match: A0A2E8YMH6_9HYPH (Pseudouridine synthase n=1 Tax=Rhodobiaceae bacterium TaxID=2026785 RepID=A0A2E8YMH6_9HYPH) HSP 1 Score: 55.8 bits (133), Expect = 8.560e-8 Identity = 27/48 (56.25%), Postives = 36/48 (75.00%), Query Frame = 1 Query: 1 NRQIRKICKYLCLKVSRLARVRFGPFSLGKVRPGGVSRVQIPDSFLRR 144 NR+IRKICKY+ L+VSRL R +GPF+LG + G+ +V P+SFL R Sbjct: 194 NREIRKICKYMDLEVSRLIRYSYGPFNLGNLNKCGIKKV--PNSFLIR 239
BLAST of mRNA_H-elongata_contig103461.288.1 vs. uniprot
Match: A0A0N1BWI4_9PROT (Pseudouridine synthase n=3 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A0N1BWI4_9PROT) HSP 1 Score: 52.0 bits (123), Expect = 2.750e-6 Identity = 27/63 (42.86%), Postives = 37/63 (58.73%), Query Frame = 1 Query: 1 NRQIRKICKYLCLKVSRLARVRFGPFSLGKVRPGGVSRV-------QIPDSFLRRLEEGKAGG 168 NR++R++ ++L L VSRL R+ +GPF LGK+ PG V V Q+PD F E A G Sbjct: 217 NREVRRVFEWLGLPVSRLIRIAYGPFQLGKLDPGAVEEVPRRVLRDQMPDFFPAEEEPAPADG 279
BLAST of mRNA_H-elongata_contig103461.288.1 vs. uniprot
Match: A0A847SYK3_9ARCH (rRNA pseudouridine synthase n=1 Tax=Methanomassiliicoccus sp. TaxID=2528041 RepID=A0A847SYK3_9ARCH) HSP 1 Score: 51.2 bits (121), Expect = 4.390e-6 Identity = 26/48 (54.17%), Postives = 33/48 (68.75%), Query Frame = 1 Query: 1 NRQIRKICKYLCLKVSRLARVRFGPFSLGKVRPGGVSRVQIPDSFLRR 144 NR++R I YL L+V +L RVRFGPFSLGK+ GG+ +IP L R Sbjct: 197 NREVRNIMAYLGLQVKQLIRVRFGPFSLGKLPCGGIE--EIPKRVLHR 242
BLAST of mRNA_H-elongata_contig103461.288.1 vs. uniprot
Match: UPI000AD0C1B5 (rRNA pseudouridine synthase n=1 Tax=Sphingomonas sp. CCH9-F2 TaxID=1768778 RepID=UPI000AD0C1B5) HSP 1 Score: 51.2 bits (121), Expect = 4.540e-6 Identity = 22/43 (51.16%), Postives = 33/43 (76.74%), Query Frame = 1 Query: 1 NRQIRKICKYLCLKVSRLARVRFGPFSLGKVRPGGVSRVQIPD 129 NR++R++ ++L L+VSRL RVR+GPF LG + GGV V++ D Sbjct: 192 NREVRRVLEHLGLRVSRLIRVRYGPFVLGDLPVGGVGEVRVAD 234
BLAST of mRNA_H-elongata_contig103461.288.1 vs. uniprot
Match: A0A2A4IAW3_9SPHN (Pseudouridine synthase n=3 Tax=Sphingomonas TaxID=13687 RepID=A0A2A4IAW3_9SPHN) HSP 1 Score: 51.2 bits (121), Expect = 5.100e-6 Identity = 22/43 (51.16%), Postives = 33/43 (76.74%), Query Frame = 1 Query: 1 NRQIRKICKYLCLKVSRLARVRFGPFSLGKVRPGGVSRVQIPD 129 NR++R++ ++L L+VSRL RVR+GPF LG + GGV V++ D Sbjct: 192 NREVRRVLEHLGLRVSRLIRVRYGPFVLGDLPVGGVGEVRVAD 234
BLAST of mRNA_H-elongata_contig103461.288.1 vs. uniprot
Match: A0A257GC70_9SPHN (Pseudouridine synthase n=1 Tax=Novosphingobium sp. PASSN1 TaxID=2015561 RepID=A0A257GC70_9SPHN) HSP 1 Score: 51.2 bits (121), Expect = 5.150e-6 Identity = 23/55 (41.82%), Postives = 38/55 (69.09%), Query Frame = 1 Query: 1 NRQIRKICKYLCLKVSRLARVRFGPFSLGKVRPGGVSRVQIPDSFLRRLEEGKAG 165 NR++R++ ++L L+VSRL R+R+GPF LG++ GG ++P + R +G AG Sbjct: 257 NREVRRVLEHLGLEVSRLLRLRYGPFDLGELPRGGAE--EVPQIVVERFRKGLAG 309
BLAST of mRNA_H-elongata_contig103461.288.1 vs. uniprot
Match: UPI00068CE4BF (rRNA pseudouridine synthase n=1 Tax=Thermopetrobacter sp. TC1 TaxID=1495045 RepID=UPI00068CE4BF) HSP 1 Score: 50.1 bits (118), Expect = 1.150e-5 Identity = 25/54 (46.30%), Postives = 36/54 (66.67%), Query Frame = 1 Query: 1 NRQIRKICKYLCLKVSRLARVRFGPFSLGKVRPGGVSRV---QIPDSFLRRLEE 153 NR+IR+IC++L LKV+RL R +GPF LG ++ G V V Q+ + R L+E Sbjct: 196 NREIRRICEHLGLKVNRLLRTAYGPFQLGALKKGEVVEVPRKQLKEQLGRLLDE 249
BLAST of mRNA_H-elongata_contig103461.288.1 vs. uniprot
Match: A0A7K4ADH5_9EURY (rRNA pseudouridine synthase n=1 Tax=Euryarchaeota archaeon TaxID=2026739 RepID=A0A7K4ADH5_9EURY) HSP 1 Score: 50.1 bits (118), Expect = 1.190e-5 Identity = 26/56 (46.43%), Postives = 37/56 (66.07%), Query Frame = 1 Query: 1 NRQIRKICKYLCLKVSRLARVRFGPFSLGKVRPGGVSRV--QIPDSFLRRLEEGKA 162 NR++R I +L LKVSRL RV +GPFSLGK+R V V ++ + LR+ + K+ Sbjct: 210 NREVRNIMSHLGLKVSRLIRVEYGPFSLGKLRKSSVVEVSPRVLKNLLRKYFDDKS 265 The following BLAST results are available for this feature:
BLAST of mRNA_H-elongata_contig103461.288.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-elongata_contig103461.288.1 >prot_H-elongata_contig103461.288.1 ID=prot_H-elongata_contig103461.288.1|Name=mRNA_H-elongata_contig103461.288.1|organism=Himanthalia elongata Himel1 dioecious|type=polypeptide|length=56bp NRQIRKICKYLCLKVSRLARVRFGPFSLGKVRPGGVSRVQIPDSFLRRLEback to top mRNA from alignment at H-elongata_contig103461:492..659+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-elongata_contig103461.288.1 ID=mRNA_H-elongata_contig103461.288.1|Name=mRNA_H-elongata_contig103461.288.1|organism=Himanthalia elongata Himel1 dioecious|type=mRNA|length=168bp|location=Sequence derived from alignment at H-elongata_contig103461:492..659+ (Himanthalia elongata Himel1 dioecious)back to top Coding sequence (CDS) from alignment at H-elongata_contig103461:492..659+ >mRNA_H-elongata_contig103461.288.1 ID=mRNA_H-elongata_contig103461.288.1|Name=mRNA_H-elongata_contig103461.288.1|organism=Himanthalia elongata Himel1 dioecious|type=CDS|length=336bp|location=Sequence derived from alignment at H-elongata_contig103461:492..659+ (Himanthalia elongata Himel1 dioecious)back to top |