mRNA_H-elongata_contig102856.249.1 (mRNA) Himanthalia elongata Himel1 dioecious
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_H-elongata_contig102856.249.1 vs. uniprot
Match: D7FMF7_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FMF7_ECTSI) HSP 1 Score: 96.3 bits (238), Expect = 8.460e-22 Identity = 48/54 (88.89%), Postives = 49/54 (90.74%), Query Frame = 1 Query: 1 LGSLIVHNATTTRYRLMATAREHYERELKQQAFLMLGSLEAFGNPVGLLRGMGQ 162 L SLIVHN TTTR RL TAREHYERELKQQAFLMLGSLEAFGNPVGL+RGMGQ Sbjct: 335 LKSLIVHNTTTTRSRLTLTAREHYERELKQQAFLMLGSLEAFGNPVGLVRGMGQ 388
BLAST of mRNA_H-elongata_contig102856.249.1 vs. uniprot
Match: A0A6H5KXT8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KXT8_9PHAE) HSP 1 Score: 96.3 bits (238), Expect = 8.490e-22 Identity = 48/54 (88.89%), Postives = 49/54 (90.74%), Query Frame = 1 Query: 1 LGSLIVHNATTTRYRLMATAREHYERELKQQAFLMLGSLEAFGNPVGLLRGMGQ 162 L SLIVHN TTTR RL TAREHYERELKQQAFLMLGSLEAFGNPVGL+RGMGQ Sbjct: 688 LKSLIVHNTTTTRSRLTLTAREHYERELKQQAFLMLGSLEAFGNPVGLVRGMGQ 741
BLAST of mRNA_H-elongata_contig102856.249.1 vs. uniprot
Match: A0A836C849_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836C849_9STRA) HSP 1 Score: 60.5 bits (145), Expect = 3.420e-9 Identity = 30/54 (55.56%), Postives = 35/54 (64.81%), Query Frame = 1 Query: 1 LGSLIVHNATTTRYRLMATAREHYERELKQQAFLMLGSLEAFGNPVGLLRGMGQ 162 L S I+HN T +L A A HY +KQ LMLG+LEAFGNPVGL RG+ Q Sbjct: 5333 LASFIMHNETIATQQLGAIAAAHYLSTVKQHVLLMLGALEAFGNPVGLFRGVSQ 5386 The following BLAST results are available for this feature:
BLAST of mRNA_H-elongata_contig102856.249.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-elongata_contig102856.249.1 >prot_H-elongata_contig102856.249.1 ID=prot_H-elongata_contig102856.249.1|Name=mRNA_H-elongata_contig102856.249.1|organism=Himanthalia elongata Himel1 dioecious|type=polypeptide|length=60bp LGSLIVHNATTTRYRLMATAREHYERELKQQAFLMLGSLEAFGNPVGLLRback to top mRNA from alignment at H-elongata_contig102856:700..879- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-elongata_contig102856.249.1 ID=mRNA_H-elongata_contig102856.249.1|Name=mRNA_H-elongata_contig102856.249.1|organism=Himanthalia elongata Himel1 dioecious|type=mRNA|length=180bp|location=Sequence derived from alignment at H-elongata_contig102856:700..879- (Himanthalia elongata Himel1 dioecious)back to top Coding sequence (CDS) from alignment at H-elongata_contig102856:700..879- >mRNA_H-elongata_contig102856.249.1 ID=mRNA_H-elongata_contig102856.249.1|Name=mRNA_H-elongata_contig102856.249.1|organism=Himanthalia elongata Himel1 dioecious|type=CDS|length=360bp|location=Sequence derived from alignment at H-elongata_contig102856:700..879- (Himanthalia elongata Himel1 dioecious)back to top |