mRNA_H-elongata_contig10189.165.1 (mRNA) Himanthalia elongata Himel1 dioecious
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_H-elongata_contig10189.165.1 vs. uniprot
Match: A0A6H5JS47_9PHAE (Btz domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JS47_9PHAE) HSP 1 Score: 77.8 bits (190), Expect = 1.770e-10 Identity = 37/45 (82.22%), Postives = 41/45 (91.11%), Query Frame = 1 Query: 79 DEPWGHEGYEEVLRAEEEGRQISTSSTFWSNPTGK-GRTGSWRGG 210 D PWGHEGYEEVLRAEEEGR I++SS FWSNPTGK GR+G+WRGG Sbjct: 280 DLPWGHEGYEEVLRAEEEGRPIASSSGFWSNPTGKDGRSGAWRGG 324 The following BLAST results are available for this feature:
BLAST of mRNA_H-elongata_contig10189.165.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-elongata_contig10189.165.1 >prot_H-elongata_contig10189.165.1 ID=prot_H-elongata_contig10189.165.1|Name=mRNA_H-elongata_contig10189.165.1|organism=Himanthalia elongata Himel1 dioecious|type=polypeptide|length=930bp MARVASSAIQPGYQSGKIENMPNTSGWGEANPSEEPNPPGKPDPSGWRKPback to top mRNA from alignment at H-elongata_contig10189:629..8641+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-elongata_contig10189.165.1 ID=mRNA_H-elongata_contig10189.165.1|Name=mRNA_H-elongata_contig10189.165.1|organism=Himanthalia elongata Himel1 dioecious|type=mRNA|length=8013bp|location=Sequence derived from alignment at H-elongata_contig10189:629..8641+ (Himanthalia elongata Himel1 dioecious)back to top Coding sequence (CDS) from alignment at H-elongata_contig10189:629..8641+ >mRNA_H-elongata_contig10189.165.1 ID=mRNA_H-elongata_contig10189.165.1|Name=mRNA_H-elongata_contig10189.165.1|organism=Himanthalia elongata Himel1 dioecious|type=CDS|length=5580bp|location=Sequence derived from alignment at H-elongata_contig10189:629..8641+ (Himanthalia elongata Himel1 dioecious)back to top |