prot_H-akashiwo_Contig1030.7.1 (polypeptide) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig1030.7.1 vs. uniprot
Match: W2QFY1_PHYPN (Mur_ligase_M domain-containing protein n=13 Tax=Phytophthora TaxID=4783 RepID=W2QFY1_PHYPN) HSP 1 Score: 51.2 bits (121), Expect = 8.200e-6 Identity = 29/71 (40.85%), Postives = 40/71 (56.34%), Query Frame = 0 Query: 3 VEALRAAAAPVQITGESGSVKETISTLLEKL--------VHPDEDVVVICGSTFLMSDARDALGLSYPSDA 65 +E + A A GE V ETIST+ + + D++VVV+CGS FLM++AR ALGL P D+ Sbjct: 465 LEEINVALANATAEGEQARVYETISTIKDGVNAALAASRASSDDEVVVVCGSVFLMAEARQALGLKEPIDS 535
BLAST of mRNA_H-akashiwo_Contig1030.7.1 vs. uniprot
Match: A0A8J5MHS4_9STRA (Uncharacterized protein n=1 Tax=Phytophthora aleatoria TaxID=2496075 RepID=A0A8J5MHS4_9STRA) HSP 1 Score: 49.7 bits (117), Expect = 2.910e-5 Identity = 29/71 (40.85%), Postives = 40/71 (56.34%), Query Frame = 0 Query: 3 VEALRAAAAPVQITGESGSVKETISTLLEKL--------VHPDEDVVVICGSTFLMSDARDALGLSYPSDA 65 +E + A A GE V ETIST+ + + D++VVV+CGS FLM++AR ALGL P D+ Sbjct: 473 LEEINLALANATAEGEMPRVYETISTIKDGVNAALAASRASSDDEVVVVCGSVFLMAEARQALGLKEPIDS 543
BLAST of mRNA_H-akashiwo_Contig1030.7.1 vs. uniprot
Match: A0A2P4YSC5_9STRA (Folylpolyglutamate synthase n=2 Tax=Phytophthora palmivora var. palmivora TaxID=611791 RepID=A0A2P4YSC5_9STRA) HSP 1 Score: 48.9 bits (115), Expect = 5.370e-5 Identity = 29/71 (40.85%), Postives = 39/71 (54.93%), Query Frame = 0 Query: 3 VEALRAAAAPVQITGESGSVKETISTLLEKL--------VHPDEDVVVICGSTFLMSDARDALGLSYPSDA 65 +E + A A GE ETIST+ E + D++VVV+CGS FLM++AR ALGL P D+ Sbjct: 467 LEEVNLALANATTEGEKAYQYETISTIKEGVNAALAASRASSDDEVVVVCGSVFLMAEARQALGLKEPIDS 537 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig1030.7.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-akashiwo_Contig1030.7.1 ID=prot_H-akashiwo_Contig1030.7.1|Name=mRNA_H-akashiwo_Contig1030.7.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=67bpback to top |