prot_H-akashiwo_Contig100.40.1 (polypeptide) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig100.40.1 vs. uniprot
Match: A0A7S3Y243_HETAK (Hypothetical protein n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3Y243_HETAK) HSP 1 Score: 98.6 bits (244), Expect = 8.200e-23 Identity = 52/52 (100.00%), Postives = 52/52 (100.00%), Query Frame = 0 Query: 1 MWVPLATGAVLFVGIGVLQASLGDVMEAEAGLGSASGARARKENTRRKKFLD 52 MWVPLATGAVLFVGIGVLQASLGDVMEAEAGLGSASGARARKENTRRKKFLD Sbjct: 467 MWVPLATGAVLFVGIGVLQASLGDVMEAEAGLGSASGARARKENTRRKKFLD 518
BLAST of mRNA_H-akashiwo_Contig100.40.1 vs. uniprot
Match: A0A6U1Q394_9STRA (Hypothetical protein n=1 Tax=Fibrocapsa japonica TaxID=94617 RepID=A0A6U1Q394_9STRA) HSP 1 Score: 62.8 bits (151), Expect = 4.410e-11 Identity = 33/51 (64.71%), Postives = 39/51 (76.47%), Query Frame = 0 Query: 2 WVPLATGAVLFVGIGVLQASLGDVMEAEAGLGSASGARARKENTRRKKFLD 52 WVP+ L G+G+LQ SLG+V + EA LGSASGARARKE+TR KKFLD Sbjct: 93 WVPVGVAIALLGGVGLLQLSLGNVADDEAMLGSASGARARKESTRNKKFLD 143
BLAST of mRNA_H-akashiwo_Contig100.40.1 vs. uniprot
Match: D7G8H6_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G8H6_ECTSI) HSP 1 Score: 58.2 bits (139), Expect = 4.420e-9 Identity = 31/46 (67.39%), Postives = 36/46 (78.26%), Query Frame = 0 Query: 1 MWVPLATGAVLFVGIGVLQASLGDVMEAEAGLGSASGARARKENTR 46 MWVPLA G VL +GIG+LQ SLGDVM EA LG+ SGARA K++ R Sbjct: 114 MWVPLAVGFVLTLGIGLLQGSLGDVMNDEAKLGALSGARAAKQSAR 159
BLAST of mRNA_H-akashiwo_Contig100.40.1 vs. uniprot
Match: A0A7S2SFC9_9STRA (Hypothetical protein n=1 Tax=Rhizochromulina marina TaxID=1034831 RepID=A0A7S2SFC9_9STRA) HSP 1 Score: 49.3 bits (116), Expect = 7.860e-6 Identity = 26/45 (57.78%), Postives = 33/45 (73.33%), Query Frame = 0 Query: 3 VPLATGAVLFVGIGVLQASLGDVMEAEAGLGSASGARARKENTRR 47 +P+A A +FVG+G+LQ SLGDV EA LG +SGA ARKE R+ Sbjct: 92 IPVAFAAAIFVGVGLLQGSLGDVYGQEADLGMSSGANARKEAERK 136 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig100.40.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-akashiwo_Contig100.40.1 ID=prot_H-akashiwo_Contig100.40.1|Name=mRNA_H-akashiwo_Contig100.40.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=53bpback to top |