prot_H-akashiwo_Contig884.7.1 (polypeptide) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig884.7.1 vs. uniprot
Match: A0A7S4D5B8_HETAK (Hypothetical protein n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S4D5B8_HETAK) HSP 1 Score: 116 bits (290), Expect = 3.970e-29 Identity = 56/56 (100.00%), Postives = 56/56 (100.00%), Query Frame = 0 Query: 1 MGLVLAFVLPAACYLKIRWQKKNNLVKKGAMVLLIGSIAFTVFCSYQSIGHALSEN 56 MGLVLAFVLPAACYLKIRWQKKNNLVKKGAMVLLIGSIAFTVFCSYQSIGHALSEN Sbjct: 466 MGLVLAFVLPAACYLKIRWQKKNNLVKKGAMVLLIGSIAFTVFCSYQSIGHALSEN 521
BLAST of mRNA_H-akashiwo_Contig884.7.1 vs. uniprot
Match: A0A7S2KBB1_9STRA (Hypothetical protein n=1 Tax=Leptocylindrus danicus TaxID=163516 RepID=A0A7S2KBB1_9STRA) HSP 1 Score: 47.8 bits (112), Expect = 7.970e-5 Identity = 20/50 (40.00%), Postives = 34/50 (68.00%), Query Frame = 0 Query: 1 MGLVLAFVLPAACYLKIRWQKK-NNLVKKGAMVLLIGSIAFTVFCSYQSI 49 +G+++ F++PAACYLK+RW K + GA+ LLI S+ + C+ Q++ Sbjct: 189 IGMMIGFIIPAACYLKLRWHKGWRRGLNLGALALLIFSVVGAIACTAQTV 238 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig884.7.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-akashiwo_Contig884.7.1 ID=prot_H-akashiwo_Contig884.7.1|Name=mRNA_H-akashiwo_Contig884.7.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=57bpback to top |