prot_H-akashiwo_Contig943.3.1 (polypeptide) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig943.3.1 vs. uniprot
Match: A0A2N1LQZ7_TRIHA (Uncharacterized protein n=1 Tax=Trichoderma harzianum TaxID=5544 RepID=A0A2N1LQZ7_TRIHA) HSP 1 Score: 50.1 bits (118), Expect = 8.170e-6 Identity = 24/39 (61.54%), Postives = 28/39 (71.79%), Query Frame = 0 Query: 1 MVLNTGMVDQEATDETGATPLHLASARGHIRVVDLLMDR 39 M+L+T +VD A D GATPLHLAS RGH VV L+DR Sbjct: 1 MLLDTNLVDVNARDADGATPLHLASERGHTSVVKFLVDR 39
BLAST of mRNA_H-akashiwo_Contig943.3.1 vs. uniprot
Match: A0A3L6MZP8_FUSOX (Uncharacterized protein n=1 Tax=Fusarium oxysporum f. sp. cepae TaxID=396571 RepID=A0A3L6MZP8_FUSOX) HSP 1 Score: 47.4 bits (111), Expect = 9.820e-6 Identity = 22/45 (48.89%), Postives = 32/45 (71.11%), Query Frame = 0 Query: 1 MVLNTGMVDQEATDETGATPLHLASARGHIRVVDLLMDRGARLNA 45 ++L+TG+VD +A DE G TPL S GH+ VV +L+D+GA + A Sbjct: 13 LLLDTGIVDIDARDEDGFTPLIATSVNGHMEVVKMLLDKGADVMA 57
BLAST of mRNA_H-akashiwo_Contig943.3.1 vs. uniprot
Match: A0A535IML2_9CHLR (Ankyrin repeat domain-containing protein (Fragment) n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A535IML2_9CHLR) HSP 1 Score: 46.6 bits (109), Expect = 1.890e-5 Identity = 22/45 (48.89%), Postives = 31/45 (68.89%), Query Frame = 0 Query: 1 MVLNTGMVDQEATDETGATPLHLASARGHIRVVDLLMDRGARLNA 45 M++ G D AT + G TPLH A+ G + ++DLL+DRGARL+A Sbjct: 10 MLIEAG-ADVNATQQGGYTPLHAAAQNGDVELIDLLLDRGARLDA 53
BLAST of mRNA_H-akashiwo_Contig943.3.1 vs. uniprot
Match: A0A8J4U6P3_CLAMG (Transient receptor potential cation channel subfamily A member 1-like (Fragment) n=1 Tax=Clarias magur TaxID=1594786 RepID=A0A8J4U6P3_CLAMG) HSP 1 Score: 45.8 bits (107), Expect = 2.000e-5 Identity = 21/28 (75.00%), Postives = 23/28 (82.14%), Query Frame = 0 Query: 14 DETGATPLHLASARGHIRVVDLLMDRGA 41 DE G TPLHLAS GHI+VVDLL+ RGA Sbjct: 24 DENGRTPLHLASMGGHIKVVDLLLRRGA 51
BLAST of mRNA_H-akashiwo_Contig943.3.1 vs. uniprot
Match: A0A1Z8WGV0_9BACT (Uncharacterized protein (Fragment) n=2 Tax=Verrucomicrobia TaxID=74201 RepID=A0A1Z8WGV0_9BACT) HSP 1 Score: 48.5 bits (114), Expect = 2.860e-5 Identity = 22/38 (57.89%), Postives = 30/38 (78.95%), Query Frame = 0 Query: 8 VDQEATDETGATPLHLASARGHIRVVDLLMDRGARLNA 45 VD A DE G+TPLH+AS G +VV+LL++RGA++NA Sbjct: 20 VDINARDENGSTPLHIASLNGQKQVVELLINRGAKVNA 57
BLAST of mRNA_H-akashiwo_Contig943.3.1 vs. uniprot
Match: A0A0A9XKB9_LYGHE (Protein phosphatase 1 regulatory subunit 16A n=2 Tax=Lygus hesperus TaxID=30085 RepID=A0A0A9XKB9_LYGHE) HSP 1 Score: 48.5 bits (114), Expect = 2.870e-5 Identity = 21/37 (56.76%), Postives = 28/37 (75.68%), Query Frame = 0 Query: 3 LNTGMVDQEATDETGATPLHLASARGHIRVVDLLMDR 39 L G++D E DE GATPLH+ SA G+IRVV+ L+D+ Sbjct: 208 LTAGLLDLEKPDENGATPLHIGSANGYIRVVEYLLDQ 244
BLAST of mRNA_H-akashiwo_Contig943.3.1 vs. uniprot
Match: A0A0A9ZDJ2_LYGHE (Protein phosphatase 1 regulatory subunit 16A n=2 Tax=Mirini TaxID=236659 RepID=A0A0A9ZDJ2_LYGHE) HSP 1 Score: 48.5 bits (114), Expect = 2.870e-5 Identity = 21/37 (56.76%), Postives = 28/37 (75.68%), Query Frame = 0 Query: 3 LNTGMVDQEATDETGATPLHLASARGHIRVVDLLMDR 39 L G++D E DE GATPLH+ SA G+IRVV+ L+D+ Sbjct: 208 LTAGLLDLEKPDENGATPLHIGSANGYIRVVEYLLDQ 244
BLAST of mRNA_H-akashiwo_Contig943.3.1 vs. uniprot
Match: A0A2H3IV69_WOLCO (Ankyrin n=1 Tax=Wolfiporia cocos (strain MD-104) TaxID=742152 RepID=A0A2H3IV69_WOLCO) HSP 1 Score: 47.8 bits (112), Expect = 4.430e-5 Identity = 22/34 (64.71%), Postives = 25/34 (73.53%), Query Frame = 0 Query: 8 VDQEATDETGATPLHLASARGHIRVVDLLMDRGA 41 VD TDE G TPLHLA RGH +VV+LL+ RGA Sbjct: 162 VDVNETDENGYTPLHLACDRGHTKVVELLLSRGA 195
BLAST of mRNA_H-akashiwo_Contig943.3.1 vs. uniprot
Match: A0A397ST29_9GLOM (Ankyrin repeat-containing domain protein n=1 Tax=Glomus cerebriforme TaxID=658196 RepID=A0A397ST29_9GLOM) HSP 1 Score: 47.4 bits (111), Expect = 6.740e-5 Identity = 21/40 (52.50%), Postives = 30/40 (75.00%), Query Frame = 0 Query: 2 VLNTGMVDQEATDETGATPLHLASARGHIRVVDLLMDRGA 41 +L++G +D A D+ G T LH AS RGH+ V++LL+DRGA Sbjct: 154 ILDSGNIDINAKDDQGLTLLHWASDRGHLTVIELLIDRGA 193
BLAST of mRNA_H-akashiwo_Contig943.3.1 vs. uniprot
Match: A0A8C5PZA3_9ANUR (Fibronectin type III and ankyrin repeat domains 1 n=2 Tax=Leptobrachium leishanense TaxID=445787 RepID=A0A8C5PZA3_9ANUR) HSP 1 Score: 47.4 bits (111), Expect = 7.320e-5 Identity = 20/43 (46.51%), Postives = 31/43 (72.09%), Query Frame = 0 Query: 2 VLNTGMVDQEATDETGATPLHLASARGHIRVVDLLMDRGARLN 44 +L TG V + D+ G TPL +A+ +GH+R+V+LL+D GA +N Sbjct: 131 ILQTGQVKADTPDKFGLTPLMVAAQKGHLRLVELLIDHGADIN 173 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig943.3.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 12
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-akashiwo_Contig943.3.1 ID=prot_H-akashiwo_Contig943.3.1|Name=mRNA_H-akashiwo_Contig943.3.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=45bpback to top |