prot_H-akashiwo_Contig93.36.1 (polypeptide) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig93.36.1 vs. uniprot
Match: D7FKD3_ECTSI (ENTH domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FKD3_ECTSI) HSP 1 Score: 85.9 bits (211), Expect = 5.380e-18 Identity = 36/64 (56.25%), Postives = 50/64 (78.12%), Query Frame = 0 Query: 5 KKKNHNVKFKCLVLIKHICRTGRPEFRRDIQRSTDVIREHLQFKGTPDPLRGDQIYQKVRDAAR 68 KK NHN+KFKCL +IKH+C GR EF+ +QR +I++ L F G PDPLRG++IY++VR+AA+ Sbjct: 48 KKPNHNIKFKCLRIIKHVCMKGRAEFKMSMQREAQLIKDCLTFNGPPDPLRGEEIYRRVREAAK 111
BLAST of mRNA_H-akashiwo_Contig93.36.1 vs. uniprot
Match: A0A225VNV4_9STRA (ENTH domain-containing protein (Fragment) n=1 Tax=Phytophthora megakarya TaxID=4795 RepID=A0A225VNV4_9STRA) HSP 1 Score: 82.4 bits (202), Expect = 6.880e-18 Identity = 33/64 (51.56%), Postives = 52/64 (81.25%), Query Frame = 0 Query: 5 KKKNHNVKFKCLVLIKHICRTGRPEFRRDIQRSTDVIREHLQFKGTPDPLRGDQIYQKVRDAAR 68 K K+H +K+K L +IKH+CR GR +F+R++Q+ I+E LQF+GTPDPL+GD+ Y++VR++A+ Sbjct: 48 KNKHHTIKYKALQVIKHVCREGRVDFKREMQKHIPTIKECLQFRGTPDPLKGDEYYRRVRESAK 111
BLAST of mRNA_H-akashiwo_Contig93.36.1 vs. uniprot
Match: W4GG03_9STRA (ENTH domain-containing protein n=6 Tax=Aphanomyces astaci TaxID=112090 RepID=W4GG03_9STRA) HSP 1 Score: 85.5 bits (210), Expect = 7.320e-18 Identity = 37/64 (57.81%), Postives = 50/64 (78.12%), Query Frame = 0 Query: 5 KKKNHNVKFKCLVLIKHICRTGRPEFRRDIQRSTDVIREHLQFKGTPDPLRGDQIYQKVRDAAR 68 KK N+K+K L +IKHICR GR EFRR++Q+ ++E LQF+G PDPLRGD+ Y++VRDAA+ Sbjct: 48 KKNKPNIKYKALQVIKHICREGRQEFRREMQKHVPTVKEALQFRGPPDPLRGDEYYRRVRDAAK 111
BLAST of mRNA_H-akashiwo_Contig93.36.1 vs. uniprot
Match: A0A418FF60_9STRA (ENTH domain-containing protein n=8 Tax=Aphanomyces astaci TaxID=112090 RepID=A0A418FF60_9STRA) HSP 1 Score: 85.5 bits (210), Expect = 7.330e-18 Identity = 37/64 (57.81%), Postives = 50/64 (78.12%), Query Frame = 0 Query: 5 KKKNHNVKFKCLVLIKHICRTGRPEFRRDIQRSTDVIREHLQFKGTPDPLRGDQIYQKVRDAAR 68 KK N+K+K L +IKHICR GR EFRR++Q+ ++E LQF+G PDPLRGD+ Y++VRDAA+ Sbjct: 48 KKNKPNIKYKALQVIKHICREGRQEFRREMQKHVPTVKEALQFRGPPDPLRGDEYYRRVRDAAK 111
BLAST of mRNA_H-akashiwo_Contig93.36.1 vs. uniprot
Match: A0A3R7X7F1_9STRA (ENTH domain-containing protein n=1 Tax=Aphanomyces astaci TaxID=112090 RepID=A0A3R7X7F1_9STRA) HSP 1 Score: 85.5 bits (210), Expect = 7.370e-18 Identity = 37/64 (57.81%), Postives = 50/64 (78.12%), Query Frame = 0 Query: 5 KKKNHNVKFKCLVLIKHICRTGRPEFRRDIQRSTDVIREHLQFKGTPDPLRGDQIYQKVRDAAR 68 KK N+K+K L +IKHICR GR EFRR++Q+ ++E LQF+G PDPLRGD+ Y++VRDAA+ Sbjct: 48 KKNKPNIKYKALQVIKHICREGRQEFRREMQKHVPTVKEALQFRGPPDPLRGDEYYRRVRDAAK 111
BLAST of mRNA_H-akashiwo_Contig93.36.1 vs. uniprot
Match: A0A2D4BT85_PYTIN (ENTH domain-containing protein n=1 Tax=Pythium insidiosum TaxID=114742 RepID=A0A2D4BT85_PYTIN) HSP 1 Score: 85.1 bits (209), Expect = 9.980e-18 Identity = 35/64 (54.69%), Postives = 52/64 (81.25%), Query Frame = 0 Query: 5 KKKNHNVKFKCLVLIKHICRTGRPEFRRDIQRSTDVIREHLQFKGTPDPLRGDQIYQKVRDAAR 68 K K+HN+K+K L +IKH+CR GR +F+R++Q+ I+E LQF+G PDPL+GD+ Y++VRDAA+ Sbjct: 48 KNKHHNIKYKALQVIKHVCREGRVDFKREMQKHIPTIKECLQFRGPPDPLKGDEYYRRVRDAAK 111
BLAST of mRNA_H-akashiwo_Contig93.36.1 vs. uniprot
Match: F0WGG9_9STRA (Uncharacterized protein AlNc14C91G5702 n=1 Tax=Albugo laibachii Nc14 TaxID=890382 RepID=F0WGG9_9STRA) HSP 1 Score: 84.7 bits (208), Expect = 1.360e-17 Identity = 36/64 (56.25%), Postives = 52/64 (81.25%), Query Frame = 0 Query: 5 KKKNHNVKFKCLVLIKHICRTGRPEFRRDIQRSTDVIREHLQFKGTPDPLRGDQIYQKVRDAAR 68 K K+H +K+K L +IKHICR GR +F+R++QR VI+E LQF+G PDPL+GD+ Y++VR+AA+ Sbjct: 48 KNKHHTIKYKALQVIKHICREGRADFKREMQRHIPVIKECLQFRGPPDPLKGDEYYRRVREAAK 111
BLAST of mRNA_H-akashiwo_Contig93.36.1 vs. uniprot
Match: A0A024GGA8_9STRA (ENTH domain-containing protein n=3 Tax=Albugo candida TaxID=65357 RepID=A0A024GGA8_9STRA) HSP 1 Score: 84.3 bits (207), Expect = 1.860e-17 Identity = 35/64 (54.69%), Postives = 52/64 (81.25%), Query Frame = 0 Query: 5 KKKNHNVKFKCLVLIKHICRTGRPEFRRDIQRSTDVIREHLQFKGTPDPLRGDQIYQKVRDAAR 68 K K+H +K+K L +IKHICR GR +F+R++QR +I+E LQF+G PDPL+GD+ Y++VR+AA+ Sbjct: 48 KNKHHTIKYKALQVIKHICREGRADFKREMQRHIPIIKECLQFRGPPDPLKGDEYYRRVREAAK 111
BLAST of mRNA_H-akashiwo_Contig93.36.1 vs. uniprot
Match: D0NRV7_PHYIT (ENTH domain-containing protein n=15 Tax=Phytophthora TaxID=4783 RepID=D0NRV7_PHYIT) HSP 1 Score: 84.0 bits (206), Expect = 2.540e-17 Identity = 34/64 (53.12%), Postives = 52/64 (81.25%), Query Frame = 0 Query: 5 KKKNHNVKFKCLVLIKHICRTGRPEFRRDIQRSTDVIREHLQFKGTPDPLRGDQIYQKVRDAAR 68 K K+HN+K+K L +IKH+CR GR +F+R++Q+ I+E LQF+G PDPL+GD+ Y++VR+AA+ Sbjct: 48 KNKHHNIKYKALQVIKHVCREGRVDFKREMQKHIPTIKECLQFRGVPDPLKGDEYYRRVREAAK 111
BLAST of mRNA_H-akashiwo_Contig93.36.1 vs. uniprot
Match: K8YWS9_NANGC (Ccaat-box dna binding protein subunit b (Fragment) n=1 Tax=Nannochloropsis gaditana (strain CCMP526) TaxID=1093141 RepID=K8YWS9_NANGC) HSP 1 Score: 78.2 bits (191), Expect = 3.600e-17 Identity = 35/64 (54.69%), Postives = 46/64 (71.88%), Query Frame = 0 Query: 5 KKKNHNVKFKCLVLIKHICRTGRPEFRRDIQRSTDVIREHLQFKGTPDPLRGDQIYQKVRDAAR 68 K+ HNVK K L IKH+CR GR +FRRD+QR + IR LQ++G PDP RG++IY+ V AA+ Sbjct: 44 KRNQHNVKLKVLRTIKHVCRQGRTDFRRDMQRQAEAIRACLQYRGPPDPYRGEEIYRLVHAAAK 107 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig93.36.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-akashiwo_Contig93.36.1 ID=prot_H-akashiwo_Contig93.36.1|Name=mRNA_H-akashiwo_Contig93.36.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=68bpback to top |