prot_H-akashiwo_Contig93.16.1 (polypeptide) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig93.16.1 vs. uniprot
Match: A0A7S2V657_9STRA (Hypothetical protein n=1 Tax=Fibrocapsa japonica TaxID=94617 RepID=A0A7S2V657_9STRA) HSP 1 Score: 91.7 bits (226), Expect = 5.250e-20 Identity = 47/98 (47.96%), Postives = 59/98 (60.20%), Query Frame = 0 Query: 1 VAASGTRLWACWKRYRAFEHFARFLEHHN-------------MPKTNVAWSRMQTIKKAFRCLDVPYLLMKSAYLQDFVQALLFESQDEELFMQFVQH 85 ASG +L CWKR+ F+ A +H MPKT AW R+ IKK FRCL++ YLL+KS YLQDF+QALLFES E+L M F++H Sbjct: 277 AVASGQQLVCCWKRHSDFKRAAEQHKHQQEMHQRRRPKGYLYMPKTKDAWVRLGEIKKTFRCLEIQYLLLKSTYLQDFLQALLFESPTEDLLMDFMEH 374 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig93.16.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-akashiwo_Contig93.16.1 ID=prot_H-akashiwo_Contig93.16.1|Name=mRNA_H-akashiwo_Contig93.16.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=87bpback to top |