prot_H-akashiwo_Contig920.3.1 (polypeptide) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig920.3.1 vs. uniprot
Match: A0A6A3X0J2_9STRA (Uncharacterized protein n=4 Tax=Phytophthora TaxID=4783 RepID=A0A6A3X0J2_9STRA) HSP 1 Score: 58.2 bits (139), Expect = 2.800e-8 Identity = 33/64 (51.56%), Postives = 41/64 (64.06%), Query Frame = 0 Query: 7 NEKGARALLYACIEGLTDVVTELLKRDDSGVDPEPVH-----VYNPKTDCSQRLTPLLAASVNG 65 NEK ALL A +EGLT VV ELL+ +S V+ P+ VYN D + RL+PLLAAS+NG Sbjct: 159 NEKSVTALLLASLEGLTPVVVELLRTINSTVEVSPIDKQIGVVYNSAADVNVRLSPLLAASMNG 222
BLAST of mRNA_H-akashiwo_Contig920.3.1 vs. uniprot
Match: G4Z8B0_PHYSP (Uncharacterized protein n=1 Tax=Phytophthora sojae (strain P6497) TaxID=1094619 RepID=G4Z8B0_PHYSP) HSP 1 Score: 55.1 bits (131), Expect = 3.420e-7 Identity = 32/65 (49.23%), Postives = 40/65 (61.54%), Query Frame = 0 Query: 7 NEKGARALLYACIEGLTDVVTELLKR------DDSGVDPEPVHVYNPKTDCSQRLTPLLAASVNG 65 NEK ALL A +EGLT VV ELL+ + +D + VYNP D + RL+PLLAAS+NG Sbjct: 159 NEKSVTALLLASLEGLTPVVVELLRTVKQPTSEVPTIDKQVGVVYNPAADVNVRLSPLLAASMNG 223
BLAST of mRNA_H-akashiwo_Contig920.3.1 vs. uniprot
Match: A0A662XK42_9STRA (Uncharacterized protein n=2 Tax=Nothophytophthora sp. Chile5 TaxID=2483409 RepID=A0A662XK42_9STRA) HSP 1 Score: 54.7 bits (130), Expect = 4.680e-7 Identity = 33/66 (50.00%), Postives = 41/66 (62.12%), Query Frame = 0 Query: 5 LANEKGARALLYACIEGLTDVVTELLKR-----DDSGVDPEPVHVYNPKTDCSQRLTPLLAASVNG 65 ++NEKG ALL A +EGLT VV +LL D VD + VYN D + RL+PLLAAS+NG Sbjct: 160 VSNEKGVTALLLASLEGLTSVVEQLLMAKKMTSDFPSVDGQIGVVYNSAADTNVRLSPLLAASMNG 225
BLAST of mRNA_H-akashiwo_Contig920.3.1 vs. uniprot
Match: A0A329RCX8_9STRA (Uncharacterized protein n=2 Tax=Phytophthora TaxID=4783 RepID=A0A329RCX8_9STRA) HSP 1 Score: 53.9 bits (128), Expect = 8.730e-7 Identity = 32/65 (49.23%), Postives = 41/65 (63.08%), Query Frame = 0 Query: 1 ADAKLANEKGARALLYACIEGLTDVVTELLKRDDSGVDPEPVHVYNPKTDCSQRLTPLLAASVNG 65 AD +NEK ALL A +EGLT VV LL+ + ++ V VYN D + RL+PLLAAS+NG Sbjct: 141 ADPHASNEKAVTALLLASLEGLTPVVLRLLEINALAIEQVGV-VYNSAADVNVRLSPLLAASMNG 204
BLAST of mRNA_H-akashiwo_Contig920.3.1 vs. uniprot
Match: A0A0P1B766_PLAHL (Ankyrin n=1 Tax=Plasmopara halstedii TaxID=4781 RepID=A0A0P1B766_PLAHL) HSP 1 Score: 51.6 bits (122), Expect = 5.710e-6 Identity = 30/64 (46.88%), Postives = 40/64 (62.50%), Query Frame = 0 Query: 7 NEKGARALLYACIEGLTDVVTELLKRDDS-----GVDPEPVHVYNPKTDCSQRLTPLLAASVNG 65 NEK ALL A +EGLT +V +L++ DS +D + VYN D + RL+PLLAAS+NG Sbjct: 147 NEKNVTALLLASLEGLTPLVVKLVENIDSKSSTQSIDQQIGAVYNAVFDVNLRLSPLLAASMNG 210
BLAST of mRNA_H-akashiwo_Contig920.3.1 vs. uniprot
Match: W2RH71_PHYPN (Uncharacterized protein n=9 Tax=Phytophthora TaxID=4783 RepID=W2RH71_PHYPN) HSP 1 Score: 51.2 bits (121), Expect = 7.830e-6 Identity = 31/70 (44.29%), Postives = 41/70 (58.57%), Query Frame = 0 Query: 1 ADAKLANEKGARALLYACIEGLTDVVTELL-----KRDDSGVDPEPVHVYNPKTDCSQRLTPLLAASVNG 65 AD +NEK ALL A +EGLT VV +LL + + +D + VYN D + RL+P LAAS+NG Sbjct: 147 ADPHASNEKAVTALLLASLEGLTPVVVQLLGTMRPQINTLAIDKQIGVVYNSAADVNVRLSPFLAASMNG 216
BLAST of mRNA_H-akashiwo_Contig920.3.1 vs. uniprot
Match: D0MU39_PHYIT (Uncharacterized protein n=2 Tax=Phytophthora infestans TaxID=4787 RepID=D0MU39_PHYIT) HSP 1 Score: 49.3 bits (116), Expect = 3.750e-5 Identity = 31/69 (44.93%), Postives = 42/69 (60.87%), Query Frame = 0 Query: 1 ADAKLANEKGARALLYACIEGLTDVVTELLK----RDDSGVDPEPVHVYNPKTDCSQRLTPLLAASVNG 65 A+ +NEK ALL A +EGLT VV LL+ +++S + VYN D + RL+PLLAAS+NG Sbjct: 143 ANPHASNEKAVTALLLASLEGLTPVVVRLLETMNTQENSLAIGQVGVVYNSAADVNVRLSPLLAASMNG 211 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig920.3.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 7
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-akashiwo_Contig920.3.1 ID=prot_H-akashiwo_Contig920.3.1|Name=mRNA_H-akashiwo_Contig920.3.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=66bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|