prot_H-akashiwo_Contig918.9.1 (polypeptide) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig918.9.1 vs. uniprot
Match: A0A7S3UVA6_HETAK (Hypothetical protein n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3UVA6_HETAK) HSP 1 Score: 87.8 bits (216), Expect = 2.270e-20 Identity = 46/46 (100.00%), Postives = 46/46 (100.00%), Query Frame = 0 Query: 1 MARQLDELYDLRDQHNDLLMNILGEEQEAEAQREGLLASVPAGNER 46 MARQLDELYDLRDQHNDLLMNILGEEQEAEAQREGLLASVPAGNER Sbjct: 71 MARQLDELYDLRDQHNDLLMNILGEEQEAEAQREGLLASVPAGNER 116
BLAST of mRNA_H-akashiwo_Contig918.9.1 vs. uniprot
Match: A0A7S3XMT6_HETAK (Hypothetical protein n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3XMT6_HETAK) HSP 1 Score: 87.8 bits (216), Expect = 9.330e-20 Identity = 46/46 (100.00%), Postives = 46/46 (100.00%), Query Frame = 0 Query: 1 MARQLDELYDLRDQHNDLLMNILGEEQEAEAQREGLLASVPAGNER 46 MARQLDELYDLRDQHNDLLMNILGEEQEAEAQREGLLASVPAGNER Sbjct: 135 MARQLDELYDLRDQHNDLLMNILGEEQEAEAQREGLLASVPAGNER 180 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig918.9.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-akashiwo_Contig918.9.1 ID=prot_H-akashiwo_Contig918.9.1|Name=mRNA_H-akashiwo_Contig918.9.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=71bpback to top |