prot_H-akashiwo_Contig915.7.1 (polypeptide) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig915.7.1 vs. uniprot
Match: A0A7S3UZ42_HETAK (Hypothetical protein n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3UZ42_HETAK) HSP 1 Score: 102 bits (254), Expect = 2.590e-26 Identity = 58/58 (100.00%), Postives = 58/58 (100.00%), Query Frame = 0 Query: 14 GTSDQKPSSKRSSDDSTGSWVVVDNEAEKTKESPDLTVVAEAEEASEVAEQMVLEAVD 71 GTSDQKPSSKRSSDDSTGSWVVVDNEAEKTKESPDLTVVAEAEEASEVAEQMVLEAVD Sbjct: 53 GTSDQKPSSKRSSDDSTGSWVVVDNEAEKTKESPDLTVVAEAEEASEVAEQMVLEAVD 110
BLAST of mRNA_H-akashiwo_Contig915.7.1 vs. uniprot
Match: A0A7S3UX88_HETAK (Hypothetical protein (Fragment) n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3UX88_HETAK) HSP 1 Score: 102 bits (254), Expect = 1.900e-25 Identity = 58/58 (100.00%), Postives = 58/58 (100.00%), Query Frame = 0 Query: 14 GTSDQKPSSKRSSDDSTGSWVVVDNEAEKTKESPDLTVVAEAEEASEVAEQMVLEAVD 71 GTSDQKPSSKRSSDDSTGSWVVVDNEAEKTKESPDLTVVAEAEEASEVAEQMVLEAVD Sbjct: 53 GTSDQKPSSKRSSDDSTGSWVVVDNEAEKTKESPDLTVVAEAEEASEVAEQMVLEAVD 110 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig915.7.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-akashiwo_Contig915.7.1 ID=prot_H-akashiwo_Contig915.7.1|Name=mRNA_H-akashiwo_Contig915.7.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=71bpback to top |