prot_H-akashiwo_Contig91.19.1 (polypeptide) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig91.19.1 vs. uniprot
Match: A0A7S2MDG1_9STRA (Hypothetical protein n=1 Tax=Dictyocha speculum TaxID=35687 RepID=A0A7S2MDG1_9STRA) HSP 1 Score: 76.6 bits (187), Expect = 9.950e-13 Identity = 33/78 (42.31%), Postives = 54/78 (69.23%), Query Frame = 0 Query: 106 ENQDKKNWIVYRRYTEFLSLYEAIKNRTPELRDFKFPNKSTFNTMQSFTKERRVSGFDELVKILLSLAVMPQEFYDFI 183 +++ +K + + RRY+EF L+E ++ + PE F+FP KS F+T +FTKERR+ GF+E +++L +L P E YDF+ Sbjct: 49 DDEKEKKYEIVRRYSEFRKLHELLRAKCPEAAGFRFPRKSKFHTHSTFTKERRLDGFNEYLQMLCNLNPQPSEVYDFL 126
BLAST of mRNA_H-akashiwo_Contig91.19.1 vs. uniprot
Match: A0A7S2CPX7_9STRA (Hypothetical protein n=1 Tax=Dictyocha speculum TaxID=35687 RepID=A0A7S2CPX7_9STRA) HSP 1 Score: 65.1 bits (157), Expect = 2.170e-8 Identity = 31/100 (31.00%), Postives = 58/100 (58.00%), Query Frame = 0 Query: 89 VELENSD-KMVTLYVLDLENQDKKNWIVYRRYTEFLSLYEAIKNRTPELRDFKFPNKSTFNTMQSFTKERRVSGFDELVKILLSL---AVMPQEFYDFIE 184 +E+E D T+Y+ + D W + +RYT+ ++ + + P++ ++FP KS FNT FT+ERR SGF++ + +LL++ + +E + F+E Sbjct: 21 IEIEKEDGTRHTIYIFKAQAADGTTWTLEKRYTDVFDMHIRLFDTNPQISGYRFPKKSVFNTFAEFTRERRRSGFEDYMGLLLTMNRVREVQRELFTFLE 120
BLAST of mRNA_H-akashiwo_Contig91.19.1 vs. uniprot
Match: A0A836CA34_9STRA (PX domain-containing protein (Fragment) n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CA34_9STRA) HSP 1 Score: 58.9 bits (141), Expect = 5.660e-8 Identity = 28/68 (41.18%), Postives = 44/68 (64.71%), Query Frame = 0 Query: 117 RRYTEFLSLYEAIKNRTPELRDFKFPNKSTFNTMQSFTKERRVSGFDELVKILLSLAVMPQEFYDFIE 184 RRY++F +L +A+++ + DF FP+KS FNT +TKERR +GF++ + +LL P E F+E Sbjct: 1 RRYSDFEALRDAVRSVHRCVSDFDFPHKSKFNTFADWTKERRRTGFEDFMMLLLGFTTRPAEVDAFLE 68 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig91.19.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-akashiwo_Contig91.19.1 ID=prot_H-akashiwo_Contig91.19.1|Name=mRNA_H-akashiwo_Contig91.19.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=291bpback to top |