prot_H-akashiwo_Contig9.23.1 (polypeptide) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig9.23.1 vs. uniprot
Match: K9UHM0_CHAP6 (tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=2 Tax=Chamaesiphon TaxID=217161 RepID=K9UHM0_CHAP6) HSP 1 Score: 62.4 bits (150), Expect = 5.880e-10 Identity = 31/44 (70.45%), Postives = 36/44 (81.82%), Query Frame = 0 Query: 9 KVLGRTTTNRPVYFAGDVEELRGKIVKVKITEARAHSLTGVQVT 52 +VLGRT NR +F GD+EELRGK+V VKITEARA SLTG +VT Sbjct: 404 QVLGRTRGNRLTFFNGDIEELRGKVVPVKITEARAFSLTGDRVT 447
BLAST of mRNA_H-akashiwo_Contig9.23.1 vs. uniprot
Match: A0A0V7ZU19_9CYAN (tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=1 Tax=Mastigocoleus testarum BC008 TaxID=371196 RepID=A0A0V7ZU19_9CYAN) HSP 1 Score: 61.2 bits (147), Expect = 1.500e-9 Identity = 27/43 (62.79%), Postives = 36/43 (83.72%), Query Frame = 0 Query: 9 KVLGRTTTNRPVYFAGDVEELRGKIVKVKITEARAHSLTGVQV 51 +V+GRT NR +FAGD++EL+GK++KVKITE RA SLTG Q+ Sbjct: 405 QVMGRTRGNRLTFFAGDIKELKGKLIKVKITEVRAFSLTGEQI 447
BLAST of mRNA_H-akashiwo_Contig9.23.1 vs. uniprot
Match: UPI00036EB697 (MiaB/RimO family radical SAM methylthiotransferase n=1 Tax=Fischerella muscicola TaxID=92938 RepID=UPI00036EB697) HSP 1 Score: 60.5 bits (145), Expect = 1.500e-9 Identity = 28/43 (65.12%), Postives = 34/43 (79.07%), Query Frame = 0 Query: 9 KVLGRTTTNRPVYFAGDVEELRGKIVKVKITEARAHSLTGVQV 51 +V+GRT TNR +F GD+ EL+GK+VKVKITE RA SLTG V Sbjct: 184 QVMGRTRTNRLTFFTGDINELKGKLVKVKITEVRAFSLTGEPV 226
BLAST of mRNA_H-akashiwo_Contig9.23.1 vs. uniprot
Match: A0A8J7IUW0_9CYAN (tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=1 Tax=Lusitaniella coriacea LEGE 07157 TaxID=945747 RepID=A0A8J7IUW0_9CYAN) HSP 1 Score: 60.8 bits (146), Expect = 2.060e-9 Identity = 29/40 (72.50%), Postives = 34/40 (85.00%), Query Frame = 0 Query: 9 KVLGRTTTNRPVYFAGDVEELRGKIVKVKITEARAHSLTG 48 +V+GRT NR +FAGD+E L+GKIVKVKITEARA SLTG Sbjct: 404 QVMGRTQGNRLTFFAGDIEALKGKIVKVKITEARAFSLTG 443
BLAST of mRNA_H-akashiwo_Contig9.23.1 vs. uniprot
Match: A0A0M0SNK6_9CYAN (tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=8 Tax=Nostocales TaxID=1161 RepID=A0A0M0SNK6_9CYAN) HSP 1 Score: 60.5 bits (145), Expect = 2.810e-9 Identity = 28/43 (65.12%), Postives = 34/43 (79.07%), Query Frame = 0 Query: 9 KVLGRTTTNRPVYFAGDVEELRGKIVKVKITEARAHSLTGVQV 51 +V+GRT TNR +F GD+ EL+GK+VKVKITE RA SLTG V Sbjct: 388 QVMGRTRTNRLTFFTGDIHELKGKLVKVKITEVRAFSLTGEPV 430
BLAST of mRNA_H-akashiwo_Contig9.23.1 vs. uniprot
Match: A0A0C2LEB1_9CYAN (tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=22 Tax=Nostocales TaxID=1161 RepID=A0A0C2LEB1_9CYAN) HSP 1 Score: 60.1 bits (144), Expect = 3.840e-9 Identity = 27/43 (62.79%), Postives = 35/43 (81.40%), Query Frame = 0 Query: 9 KVLGRTTTNRPVYFAGDVEELRGKIVKVKITEARAHSLTGVQV 51 +V+GRT NR +FAGD+ EL+GK+VKVKITE RA SLTG ++ Sbjct: 388 QVMGRTRGNRLTFFAGDINELKGKLVKVKITEVRAFSLTGEEI 430
BLAST of mRNA_H-akashiwo_Contig9.23.1 vs. uniprot
Match: A0A6P0NKQ9_9CYAN (TRAM domain-containing protein (Fragment) n=1 Tax=Moorena sp. SIO3C2 TaxID=2607842 RepID=A0A6P0NKQ9_9CYAN) HSP 1 Score: 55.8 bits (133), Expect = 4.650e-9 Identity = 25/41 (60.98%), Postives = 32/41 (78.05%), Query Frame = 0 Query: 9 KVLGRTTTNRPVYFAGDVEELRGKIVKVKITEARAHSLTGV 49 +V+GRT NR +F GD+ EL+GK+V VKITE RA SLTG+ Sbjct: 25 QVMGRTRGNRLTFFDGDINELKGKLVNVKITEVRAFSLTGI 65
BLAST of mRNA_H-akashiwo_Contig9.23.1 vs. uniprot
Match: K9S3R7_9CYAN (tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=1 Tax=Geitlerinema sp. PCC 7407 TaxID=1173025 RepID=K9S3R7_9CYAN) HSP 1 Score: 59.7 bits (143), Expect = 5.250e-9 Identity = 27/40 (67.50%), Postives = 34/40 (85.00%), Query Frame = 0 Query: 9 KVLGRTTTNRPVYFAGDVEELRGKIVKVKITEARAHSLTG 48 +V+GRT NR +FAGD++ELRG++VKVKITE RA SLTG Sbjct: 404 QVMGRTRGNRLTFFAGDIQELRGQVVKVKITEVRAFSLTG 443
BLAST of mRNA_H-akashiwo_Contig9.23.1 vs. uniprot
Match: A0A6B3M407_9CYAN (tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=5 Tax=Cyanobacteria TaxID=1117 RepID=A0A6B3M407_9CYAN) HSP 1 Score: 59.7 bits (143), Expect = 5.260e-9 Identity = 28/46 (60.87%), Postives = 37/46 (80.43%), Query Frame = 0 Query: 9 KVLGRTTTNRPVYFAGDVEELRGKIVKVKITEARAHSLTGVQVTTS 54 +V+GRT NR +FAGD+EEL+GK+V+VKIT+ RA SLTG +V S Sbjct: 404 QVMGRTRGNRLTFFAGDIEELKGKLVEVKITQVRAFSLTGERVNES 449
BLAST of mRNA_H-akashiwo_Contig9.23.1 vs. uniprot
Match: A0A0T7BZA8_9CYAN (tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=5 Tax=Cyanobacteria TaxID=1117 RepID=A0A0T7BZA8_9CYAN) HSP 1 Score: 59.3 bits (142), Expect = 7.170e-9 Identity = 27/41 (65.85%), Postives = 34/41 (82.93%), Query Frame = 0 Query: 9 KVLGRTTTNRPVYFAGDVEELRGKIVKVKITEARAHSLTGV 49 +V+GRT NR +F GD++EL+GK+VKVKITE RA SLTGV Sbjct: 388 QVMGRTGGNRLTFFTGDIQELKGKLVKVKITEVRAFSLTGV 428 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig9.23.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-akashiwo_Contig9.23.1 ID=prot_H-akashiwo_Contig9.23.1|Name=mRNA_H-akashiwo_Contig9.23.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=56bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|