prot_H-akashiwo_Contig848.4.1 (polypeptide) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig848.4.1 vs. uniprot
Match: A0A7S3XR38_HETAK (Hypothetical protein n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3XR38_HETAK) HSP 1 Score: 104 bits (259), Expect = 9.010e-25 Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 0 Query: 12 MEINLEQLAENCDVSLAKATSALIFRSGGAIFGSLFAGKLLNLVEPHSVLISSV 65 MEINLEQLAENCDVSLAKATSALIFRSGGAIFGSLFAGKLLNLVEPHSVLISSV Sbjct: 1 MEINLEQLAENCDVSLAKATSALIFRSGGAIFGSLFAGKLLNLVEPHSVLISSV 54
BLAST of mRNA_H-akashiwo_Contig848.4.1 vs. uniprot
Match: A0A7S3XVX1_HETAK (Hypothetical protein n=2 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3XVX1_HETAK) HSP 1 Score: 80.9 bits (198), Expect = 3.130e-16 Identity = 38/63 (60.32%), Postives = 51/63 (80.95%), Query Frame = 0 Query: 3 FVSGVLVLGMEINLEQLAENCDVSLAKATSALIFRSGGAIFGSLFAGKLLNLVEPHSVLISSV 65 FV G+LV+GME+NLEQ A NC VSL KA+ +LI+RS G++ G+LFAGK+L+ EPH+VL + V Sbjct: 41 FVCGILVIGMEMNLEQFAGNCGVSLDKASLSLIYRSSGSVVGTLFAGKILSTAEPHTVLYACV 103 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig848.4.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-akashiwo_Contig848.4.1 ID=prot_H-akashiwo_Contig848.4.1|Name=mRNA_H-akashiwo_Contig848.4.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=70bpback to top |