prot_H-akashiwo_Contig845.1.1 (polypeptide) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig845.1.1 vs. uniprot
Match: A0A7S3UWK5_HETAK (Hypothetical protein (Fragment) n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3UWK5_HETAK) HSP 1 Score: 94.7 bits (234), Expect = 1.880e-23 Identity = 46/47 (97.87%), Postives = 46/47 (97.87%), Query Frame = 0 Query: 1 SRYSKFLLRPPHHAANDSESLDQSSGLTWGSLVTATQQPQTFILEIT 47 SRYSKFLLRPPHHA NDSESLDQSSGLTWGSLVTATQQPQTFILEIT Sbjct: 47 SRYSKFLLRPPHHATNDSESLDQSSGLTWGSLVTATQQPQTFILEIT 93
BLAST of mRNA_H-akashiwo_Contig845.1.1 vs. uniprot
Match: A0A7S3XLV6_HETAK (Hypothetical protein (Fragment) n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3XLV6_HETAK) HSP 1 Score: 94.7 bits (234), Expect = 5.210e-23 Identity = 46/47 (97.87%), Postives = 46/47 (97.87%), Query Frame = 0 Query: 1 SRYSKFLLRPPHHAANDSESLDQSSGLTWGSLVTATQQPQTFILEIT 47 SRYSKFLLRPPHHA NDSESLDQSSGLTWGSLVTATQQPQTFILEIT Sbjct: 90 SRYSKFLLRPPHHATNDSESLDQSSGLTWGSLVTATQQPQTFILEIT 136 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig845.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-akashiwo_Contig845.1.1 ID=prot_H-akashiwo_Contig845.1.1|Name=mRNA_H-akashiwo_Contig845.1.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=47bpback to top |