prot_H-akashiwo_Contig100.21.1 (polypeptide) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig100.21.1 vs. uniprot
Match: A0A482RQK8_9ARCH (Uncharacterized protein n=1 Tax=archaeon TaxID=1906665 RepID=A0A482RQK8_9ARCH) HSP 1 Score: 53.1 bits (126), Expect = 7.150e-7 Identity = 25/41 (60.98%), Postives = 31/41 (75.61%), Query Frame = 0 Query: 11 APKIYLIGNKIDLIGLRKVSETDHAEWIENHPVAGGFFMSA 51 AP IYL+GNK+DL LRKVS DHA +I + + GGFF+SA Sbjct: 142 APHIYLVGNKVDLPHLRKVSADDHAAFIAVNKLQGGFFVSA 182
BLAST of mRNA_H-akashiwo_Contig100.21.1 vs. uniprot
Match: A0A7S0XCY9_9STRA (Hypothetical protein (Fragment) n=1 Tax=Chromulina nebulosa TaxID=96789 RepID=A0A7S0XCY9_9STRA) HSP 1 Score: 49.3 bits (116), Expect = 6.000e-6 Identity = 24/43 (55.81%), Postives = 31/43 (72.09%), Query Frame = 0 Query: 9 SPAPKIYLIGNKIDLIGLRKVSETDHAEWIENHPVAGGFFMSA 51 S IYL+GNKIDLI LR+VSE +H +IE + + GG F+SA Sbjct: 19 STCKTIYLVGNKIDLIHLRQVSEYNHKLFIETNNLRGGMFVSA 61
BLAST of mRNA_H-akashiwo_Contig100.21.1 vs. uniprot
Match: A0A485LH36_9STRA (Aste57867_21294 protein n=1 Tax=Aphanomyces stellatus TaxID=120398 RepID=A0A485LH36_9STRA) HSP 1 Score: 50.4 bits (119), Expect = 6.220e-6 Identity = 21/38 (55.26%), Postives = 28/38 (73.68%), Query Frame = 0 Query: 14 IYLIGNKIDLIGLRKVSETDHAEWIENHPVAGGFFMSA 51 +Y +GNKIDL+GLR VSE H ++ H +AGGF +SA Sbjct: 124 LYAVGNKIDLVGLRAVSEDAHHAFVATHKLAGGFLLSA 161
BLAST of mRNA_H-akashiwo_Contig100.21.1 vs. uniprot
Match: W4G3S5_9STRA (Uncharacterized protein n=3 Tax=Aphanomyces astaci TaxID=112090 RepID=W4G3S5_9STRA) HSP 1 Score: 50.1 bits (118), Expect = 9.370e-6 Identity = 20/38 (52.63%), Postives = 28/38 (73.68%), Query Frame = 0 Query: 14 IYLIGNKIDLIGLRKVSETDHAEWIENHPVAGGFFMSA 51 +YL+GNKIDL+GLR V H E+++ H +AG F +SA Sbjct: 139 VYLVGNKIDLVGLRAVGVAQHDEFVKTHHLAGAFLLSA 176
BLAST of mRNA_H-akashiwo_Contig100.21.1 vs. uniprot
Match: A0A1V9YKI4_9STRA (Rab28 family GTPase n=1 Tax=Achlya hypogyna TaxID=1202772 RepID=A0A1V9YKI4_9STRA) HSP 1 Score: 49.3 bits (116), Expect = 1.640e-5 Identity = 24/51 (47.06%), Postives = 33/51 (64.71%), Query Frame = 0 Query: 4 AEEANSPAPK---IYLIGNKIDLIGLRKVSETDHAEWIENHPVAGGFFMSA 51 A + +S PK +Y +GNKIDL+ LR VSE H ++ H +AGGF +SA Sbjct: 111 AIDVSSRKPKKRFVYAVGNKIDLVHLRAVSEAQHQAFVVAHQLAGGFLLSA 161 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig100.21.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 5
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-akashiwo_Contig100.21.1 ID=prot_H-akashiwo_Contig100.21.1|Name=mRNA_H-akashiwo_Contig100.21.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=51bpback to top |