mRNA_H-akashiwo_Contig943.5.1 (mRNA) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig943.5.1 vs. uniprot
Match: A0A6V3BZB1_HETAK (Hypothetical protein n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A6V3BZB1_HETAK) HSP 1 Score: 90.5 bits (223), Expect = 2.380e-20 Identity = 42/71 (59.15%), Postives = 48/71 (67.61%), Query Frame = 2 Query: 17 VLLQWVEDGAE-----FNAGEWKRAINPRNTPWQINGCDCGVFVCATAEWLSEGSPFTFVETHMPHLRQRM 214 VL +W++D A F+ EW INP NTP Q NG DCGVFVC TAEWLSEGS TF + MPHLR+RM Sbjct: 178 VLCKWIKDEANSKGHVFDINEWTTTINPENTPEQTNGFDCGVFVCTTAEWLSEGSDLTFSQEDMPHLRKRM 248
BLAST of mRNA_H-akashiwo_Contig943.5.1 vs. uniprot
Match: UPI000C055259 (sentrin-specific protease 1-like n=1 Tax=Stylophora pistillata TaxID=50429 RepID=UPI000C055259) HSP 1 Score: 67.8 bits (164), Expect = 1.390e-11 Identity = 28/55 (50.91%), Postives = 40/55 (72.73%), Query Frame = 2 Query: 50 FNAGEWKRAINPRNTPWQINGCDCGVFVCATAEWLSEGSPFTFVETHMPHLRQRM 214 F++ WK ++P++ P Q+NGCDCGVF C AE+LS +PF F + HMP+ R+RM Sbjct: 468 FDSTGWK-TVSPKDIPEQLNGCDCGVFACKYAEYLSRRAPFDFDQRHMPYFRRRM 521
BLAST of mRNA_H-akashiwo_Contig943.5.1 vs. uniprot
Match: A0A7K4SWX6_9CHAR (SENP2 protease (Fragment) n=1 Tax=Burhinus bistriatus TaxID=240201 RepID=A0A7K4SWX6_9CHAR) HSP 1 Score: 66.2 bits (160), Expect = 1.570e-11 Identity = 27/57 (47.37%), Postives = 37/57 (64.91%), Query Frame = 2 Query: 47 EFNAGEWK-RAINPRNTPWQINGCDCGVFVCATAEWLSEGSPFTFVETHMPHLRQRM 214 E N EW ++ P P Q+NG DCGVFVC A+++S G P F +THMP+ R++M Sbjct: 154 ELNISEWTLHSMGPHEIPQQLNGSDCGVFVCKFADYISRGKPMNFSQTHMPYFRKKM 210
BLAST of mRNA_H-akashiwo_Contig943.5.1 vs. uniprot
Match: A0A0X3PIM3_SCHSO (ULP_PROTEASE domain-containing protein n=3 Tax=Schistocephalus solidus TaxID=70667 RepID=A0A0X3PIM3_SCHSO) HSP 1 Score: 65.9 bits (159), Expect = 6.560e-11 Identity = 31/52 (59.62%), Postives = 39/52 (75.00%), Query Frame = 2 Query: 62 EWKRAINPRNT-PWQINGCDCGVFVCATAEWLSEGSPFTFVETHMPHLRQRM 214 +WK+ IN RN+ P Q NGCDCGVF+C AE+LS G+ FTF + MP +RQRM Sbjct: 390 KWKK-INTRNSVPQQENGCDCGVFLCTFAEFLSRGAEFTFSQADMPQIRQRM 440
BLAST of mRNA_H-akashiwo_Contig943.5.1 vs. uniprot
Match: UPI00077A3E5D (sentrin-specific protease 1-like n=1 Tax=Acropora digitifera TaxID=70779 RepID=UPI00077A3E5D) HSP 1 Score: 64.3 bits (155), Expect = 8.000e-11 Identity = 28/55 (50.91%), Postives = 38/55 (69.09%), Query Frame = 2 Query: 50 FNAGEWKRAINPRNTPWQINGCDCGVFVCATAEWLSEGSPFTFVETHMPHLRQRM 214 F+ EWK A P++ P Q+NGCDCGVF C AE+LS G+ F F + +P+ R+RM Sbjct: 153 FDLSEWKLAA-PKDIPEQLNGCDCGVFACKYAEYLSRGAKFDFDQRDIPYFRRRM 206
BLAST of mRNA_H-akashiwo_Contig943.5.1 vs. uniprot
Match: A0A7M3Q682_SPIER (Hypothetical protein n=1 Tax=Spirometra erinaceieuropaei TaxID=99802 RepID=A0A7M3Q682_SPIER) HSP 1 Score: 65.5 bits (158), Expect = 9.070e-11 Identity = 27/51 (52.94%), Postives = 35/51 (68.63%), Query Frame = 2 Query: 62 EWKRAINPRNTPWQINGCDCGVFVCATAEWLSEGSPFTFVETHMPHLRQRM 214 +WK+ + P Q NGCDCGVF+C AE+LS G+ FTF + MP +RQRM Sbjct: 467 KWKKINTKNSVPQQENGCDCGVFLCTFAEFLSRGAEFTFSQADMPQIRQRM 517
BLAST of mRNA_H-akashiwo_Contig943.5.1 vs. uniprot
Match: A0A0B6Z4U0_9EUPU (ULP_PROTEASE domain-containing protein n=1 Tax=Arion vulgaris TaxID=1028688 RepID=A0A0B6Z4U0_9EUPU) HSP 1 Score: 65.5 bits (158), Expect = 9.150e-11 Identity = 29/71 (40.85%), Postives = 45/71 (63.38%), Query Frame = 2 Query: 20 LLQWVEDGA------EFNAGEWKRAINPRNTPWQINGCDCGVFVCATAEWLSEGSPFTFVETHMPHLRQRM 214 +LQ++ D + FN EWK+ +N + P Q+NG DCG+F+C AE+++ G TF + HMP+ R+RM Sbjct: 607 VLQYIHDESIAKSYTAFNRNEWKQ-VNAEDNPQQMNGGDCGMFMCMYAEYITRGKEITFTQEHMPYFRRRM 676
BLAST of mRNA_H-akashiwo_Contig943.5.1 vs. uniprot
Match: UPI001CF34DF7 (LOW QUALITY PROTEIN: sentrin-specific protease 1-like n=1 Tax=Acropora millepora TaxID=45264 RepID=UPI001CF34DF7) HSP 1 Score: 64.3 bits (155), Expect = 2.340e-10 Identity = 28/55 (50.91%), Postives = 38/55 (69.09%), Query Frame = 2 Query: 50 FNAGEWKRAINPRNTPWQINGCDCGVFVCATAEWLSEGSPFTFVETHMPHLRQRM 214 F+ EWK A P++ P Q+NGCDCGVF C AE+LS G+ F F + +P+ R+RM Sbjct: 617 FDLSEWKLAA-PKDIPEQLNGCDCGVFACKYAEYLSRGAKFDFDQRDIPYFRRRM 670
BLAST of mRNA_H-akashiwo_Contig943.5.1 vs. uniprot
Match: A0A7L1HA08_9CHAR (SENP2 protease (Fragment) n=1 Tax=Nycticryphes semicollaris TaxID=227226 RepID=A0A7L1HA08_9CHAR) HSP 1 Score: 63.2 bits (152), Expect = 2.500e-10 Identity = 27/78 (34.62%), Postives = 48/78 (61.54%), Query Frame = 2 Query: 2 DYLQVVLLQWVEDGA------EFNAGEWK-RAINPRNTPWQINGCDCGVFVCATAEWLSEGSPFTFVETHMPHLRQRM 214 DY+ +LL+++++ + + + EW ++ P P Q+NG DCGVFVC A+++S P F++ HMP+ R++M Sbjct: 140 DYICQILLKYLQEESSEKRNMKMDISEWSVHSMEPHEIPQQLNGSDCGVFVCKYADYVSRDRPMNFMQAHMPYFRKKM 217
BLAST of mRNA_H-akashiwo_Contig943.5.1 vs. uniprot
Match: A0A7L0DNB3_9CHAR (SENP2 protease (Fragment) n=1 Tax=Rostratula benghalensis TaxID=118793 RepID=A0A7L0DNB3_9CHAR) HSP 1 Score: 62.8 bits (151), Expect = 3.490e-10 Identity = 26/78 (33.33%), Postives = 48/78 (61.54%), Query Frame = 2 Query: 2 DYLQVVLLQWVED------GAEFNAGEWK-RAINPRNTPWQINGCDCGVFVCATAEWLSEGSPFTFVETHMPHLRQRM 214 DY+ +LL+++++ + + EW ++ P P Q+NG DCG+F+C A+++S P F++THMP+ R++M Sbjct: 140 DYVCQLLLKYLQEESREKRNVKVDISEWSIHSMAPHEIPQQLNGSDCGIFICKYADYISRDKPMDFLQTHMPYFRKKM 217 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig943.5.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-akashiwo_Contig943.5.1 >prot_H-akashiwo_Contig943.5.1 ID=prot_H-akashiwo_Contig943.5.1|Name=mRNA_H-akashiwo_Contig943.5.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=72bp GLSAGGLAAVGRGWSGVQRWGMETSHQPKEYSLANQWLRLRRFCLRHGGVback to top mRNA from alignment at H-akashiwo_Contig943:269313..269883+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-akashiwo_Contig943.5.1 ID=mRNA_H-akashiwo_Contig943.5.1|Name=mRNA_H-akashiwo_Contig943.5.1|organism=Heterosigma akashiwo CCMP452|type=mRNA|length=571bp|location=Sequence derived from alignment at H-akashiwo_Contig943:269313..269883+ (Heterosigma akashiwo CCMP452)back to top Coding sequence (CDS) from alignment at H-akashiwo_Contig943:269313..269883+ >mRNA_H-akashiwo_Contig943.5.1 ID=mRNA_H-akashiwo_Contig943.5.1|Name=mRNA_H-akashiwo_Contig943.5.1|organism=Heterosigma akashiwo CCMP452|type=CDS|length=216bp|location=Sequence derived from alignment at H-akashiwo_Contig943:269313..269883+ (Heterosigma akashiwo CCMP452)back to top |