mRNA_H-akashiwo_Contig940.2.1 (mRNA) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig940.2.1 vs. uniprot
Match: A0A7S3XIR6_HETAK (Hypothetical protein n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3XIR6_HETAK) HSP 1 Score: 65.9 bits (159), Expect = 3.400e-10 Identity = 39/95 (41.05%), Postives = 59/95 (62.11%), Query Frame = -2 Query: 115 GCVSEDLTYYDSATSDSDDDTAK--LYVKDLSGVFILHILVVAVCVLLRWASTLKWVQHEEDKVKNSKSFRFVSDKFKELDAKVDEAVAEALGNE 393 GCVS+DLTY +T DSDD++ + LY DLSGVF+LH L++ C L+R + VQ +++ SK FRFV +K + + +++ +A G E Sbjct: 123 GCVSDDLTYI--STDDSDDESTERALYAHDLSGVFLLHGLIMVSCSLIRCVENRRGVQKAVKEIEKSKGFRFVMNKLHKAEEMLEDTLAGPEGKE 215 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig940.2.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-akashiwo_Contig940.2.1 >prot_H-akashiwo_Contig940.2.1 ID=prot_H-akashiwo_Contig940.2.1|Name=mRNA_H-akashiwo_Contig940.2.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=103bp GKGEPRPGGRCVFPLSRRRRGRRRPLSPPRLVCGGATVLVAQGLGHSLVHback to top mRNA from alignment at H-akashiwo_Contig940:66536..66941+ Legend: CDSpolypeptideUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-akashiwo_Contig940.2.1 ID=mRNA_H-akashiwo_Contig940.2.1|Name=mRNA_H-akashiwo_Contig940.2.1|organism=Heterosigma akashiwo CCMP452|type=mRNA|length=406bp|location=Sequence derived from alignment at H-akashiwo_Contig940:66536..66941+ (Heterosigma akashiwo CCMP452)back to top Coding sequence (CDS) from alignment at H-akashiwo_Contig940:66536..66941+ >mRNA_H-akashiwo_Contig940.2.1 ID=mRNA_H-akashiwo_Contig940.2.1|Name=mRNA_H-akashiwo_Contig940.2.1|organism=Heterosigma akashiwo CCMP452|type=CDS|length=309bp|location=Sequence derived from alignment at H-akashiwo_Contig940:66536..66941+ (Heterosigma akashiwo CCMP452)back to top |