mRNA_H-akashiwo_Contig94.18.1 (mRNA) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig94.18.1 vs. uniprot
Match: A0A7S3XRL6_HETAK (Hypothetical protein (Fragment) n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3XRL6_HETAK) HSP 1 Score: 72.4 bits (176), Expect = 2.090e-14 Identity = 34/39 (87.18%), Postives = 37/39 (94.87%), Query Frame = 1 Query: 64 GLFFGYQAAVYGILDQPTRSALSKCTYSLFLPALLVVNV 180 GLF GYQA+V G+LDQPTRSALSKCTYSLFLPALL+VNV Sbjct: 1 GLFLGYQASVNGVLDQPTRSALSKCTYSLFLPALLLVNV 39 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig94.18.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-akashiwo_Contig94.18.1 >prot_H-akashiwo_Contig94.18.1 ID=prot_H-akashiwo_Contig94.18.1|Name=mRNA_H-akashiwo_Contig94.18.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=60bp MGALDPQVLKVSARAVSEMLVGLFFGYQAAVYGILDQPTRSALSKCTYSLback to top mRNA from alignment at H-akashiwo_Contig94:869599..869778+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-akashiwo_Contig94.18.1 ID=mRNA_H-akashiwo_Contig94.18.1|Name=mRNA_H-akashiwo_Contig94.18.1|organism=Heterosigma akashiwo CCMP452|type=mRNA|length=180bp|location=Sequence derived from alignment at H-akashiwo_Contig94:869599..869778+ (Heterosigma akashiwo CCMP452)back to top Coding sequence (CDS) from alignment at H-akashiwo_Contig94:869599..869778+ >mRNA_H-akashiwo_Contig94.18.1 ID=mRNA_H-akashiwo_Contig94.18.1|Name=mRNA_H-akashiwo_Contig94.18.1|organism=Heterosigma akashiwo CCMP452|type=CDS|length=180bp|location=Sequence derived from alignment at H-akashiwo_Contig94:869599..869778+ (Heterosigma akashiwo CCMP452)back to top |