mRNA_H-akashiwo_Contig93.2.1 (mRNA) Heterosigma akashiwo CCMP452
Overview
Homology
The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig93.2.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-akashiwo_Contig93.2.1 >prot_H-akashiwo_Contig93.2.1 ID=prot_H-akashiwo_Contig93.2.1|Name=mRNA_H-akashiwo_Contig93.2.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=94bp FQRTLCFNLASKDFVAGPKTTPQSFPSLPDAGARFPSSCSRSCFLAESTGback to top mRNA from alignment at H-akashiwo_Contig93:219611..219913+ Legend: CDSpolypeptideUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-akashiwo_Contig93.2.1 ID=mRNA_H-akashiwo_Contig93.2.1|Name=mRNA_H-akashiwo_Contig93.2.1|organism=Heterosigma akashiwo CCMP452|type=mRNA|length=303bp|location=Sequence derived from alignment at H-akashiwo_Contig93:219611..219913+ (Heterosigma akashiwo CCMP452)back to top Coding sequence (CDS) from alignment at H-akashiwo_Contig93:219611..219913+ >mRNA_H-akashiwo_Contig93.2.1 ID=mRNA_H-akashiwo_Contig93.2.1|Name=mRNA_H-akashiwo_Contig93.2.1|organism=Heterosigma akashiwo CCMP452|type=CDS|length=282bp|location=Sequence derived from alignment at H-akashiwo_Contig93:219611..219913+ (Heterosigma akashiwo CCMP452)back to top |