mRNA_H-akashiwo_Contig83.39.1 (mRNA) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig83.39.1 vs. uniprot
Match: A0A7S4MWK1_9STRA (Hypothetical protein n=1 Tax=Odontella aurita TaxID=265563 RepID=A0A7S4MWK1_9STRA) HSP 1 Score: 76.6 bits (187), Expect = 2.020e-13 Identity = 39/68 (57.35%), Postives = 48/68 (70.59%), Query Frame = 2 Query: 2 HAGLPNLA--EGGAPRFLLAVTFRNPAARGALGHRPNLRPGYVGRHTLASFQAELAGPAPFAAAGDGV 199 HAGLPN+ EGG R +LAVTF NPAA LGH+ N+R GYVG++T+ + ELA PFA AGDG+ Sbjct: 253 HAGLPNMKAEEGGKKRIILAVTFCNPAATEELGHKSNMRQGYVGKYTMNDLRRELASSEPFALAGDGL 320
BLAST of mRNA_H-akashiwo_Contig83.39.1 vs. uniprot
Match: A0A7S0CF51_9STRA (Hypothetical protein n=1 Tax=Proboscia inermis TaxID=420281 RepID=A0A7S0CF51_9STRA) HSP 1 Score: 73.2 bits (178), Expect = 5.370e-13 Identity = 39/61 (63.93%), Postives = 42/61 (68.85%), Query Frame = 2 Query: 2 HAGLPNLAE--GGAPRFLLAVTFRNPAARGALGHRPNLRPGYVGRHTLASFQAELAGPAPF 178 H GLPNLAE GGA R L A+TFRN A+ LGH+P LRP YVG HTL SFQ EL PF Sbjct: 111 HCGLPNLAEIEGGASRLLFALTFRNLHAKEELGHKPCLRPEYVGIHTLDSFQEELRSSTPF 171
BLAST of mRNA_H-akashiwo_Contig83.39.1 vs. uniprot
Match: A0A7R9ZCB8_9STRA (Hypothetical protein n=1 Tax=Pseudictyota dubia TaxID=2749911 RepID=A0A7R9ZCB8_9STRA) HSP 1 Score: 69.7 bits (169), Expect = 5.090e-12 Identity = 36/68 (52.94%), Postives = 46/68 (67.65%), Query Frame = 2 Query: 2 HAGLPNLAE--GGAPRFLLAVTFRNPAARGALGHRPNLRPGYVGRHTLASFQAELAGPAPFAAAGDGV 199 HAGL N E GG+ R +LA+TFRNP A LGH+ N+R GYVG++TL + E+ PFA AGDG+ Sbjct: 72 HAGLTNQVEEEGGSKRIILALTFRNPEATEELGHKSNMRRGYVGKYTLDDVRREVERTEPFATAGDGL 139
BLAST of mRNA_H-akashiwo_Contig83.39.1 vs. uniprot
Match: A0A0M0JVV4_9EUKA (Uncharacterized protein n=1 Tax=Chrysochromulina tobinii TaxID=1460289 RepID=A0A0M0JVV4_9EUKA) HSP 1 Score: 62.0 bits (149), Expect = 4.090e-8 Identity = 36/63 (57.14%), Postives = 39/63 (61.90%), Query Frame = 2 Query: 2 HAGLPNLAEG--GAPRFLLAVTFRNPAARGALGHRPNLRPGYVGRH-TLASFQAELAGPAPFA 181 HAG N EG G+ R L +TFRN AR ALGH PNLRPGY R TLA + ELA PFA Sbjct: 315 HAGTANFPEGQGGSQRLLFILTFRNRKARQALGHEPNLRPGYRNRGITLADMRRELASDEPFA 377 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig83.39.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-akashiwo_Contig83.39.1 >prot_H-akashiwo_Contig83.39.1 ID=prot_H-akashiwo_Contig83.39.1|Name=mRNA_H-akashiwo_Contig83.39.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=139bp ARRPAQPGRGGRAALPAGGHLPQPGRAGRPGPPAQPAARVRGPAHAGQLPback to top mRNA from alignment at H-akashiwo_Contig83:1536515..1537044+ Legend: CDSpolypeptideUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-akashiwo_Contig83.39.1 ID=mRNA_H-akashiwo_Contig83.39.1|Name=mRNA_H-akashiwo_Contig83.39.1|organism=Heterosigma akashiwo CCMP452|type=mRNA|length=530bp|location=Sequence derived from alignment at H-akashiwo_Contig83:1536515..1537044+ (Heterosigma akashiwo CCMP452)back to top Coding sequence (CDS) from alignment at H-akashiwo_Contig83:1536515..1537044+ >mRNA_H-akashiwo_Contig83.39.1 ID=mRNA_H-akashiwo_Contig83.39.1|Name=mRNA_H-akashiwo_Contig83.39.1|organism=Heterosigma akashiwo CCMP452|type=CDS|length=417bp|location=Sequence derived from alignment at H-akashiwo_Contig83:1536515..1537044+ (Heterosigma akashiwo CCMP452)back to top |