mRNA_H-akashiwo_Contig808.3.1 (mRNA) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig808.3.1 vs. uniprot
Match: A0A7S4VTH5_9STRA (Hypothetical protein n=1 Tax=Ditylum brightwellii TaxID=49249 RepID=A0A7S4VTH5_9STRA) HSP 1 Score: 69.7 bits (169), Expect = 1.350e-12 Identity = 32/64 (50.00%), Postives = 43/64 (67.19%), Query Frame = 1 Query: 4 DIKALLSGGGNPLGADSSGLNSLHYVVWNGHIDCLKLLLANDMGVNEE-GKKESCINSQSELGY 192 ++K LL+GG NP D GL +LHY VWNGH+ C+++L+AN G + E G S IN QS+ GY Sbjct: 17 ELKNLLAGGANPCSVDEKGLTALHYAVWNGHLQCVEILVANHWGKHHETGDVCSSINLQSKTGY 80
BLAST of mRNA_H-akashiwo_Contig808.3.1 vs. uniprot
Match: A0A482S1M6_9ARCH (Ankyrin repeat protein n=1 Tax=archaeon TaxID=1906665 RepID=A0A482S1M6_9ARCH) HSP 1 Score: 65.9 bits (159), Expect = 1.390e-12 Identity = 26/63 (41.27%), Postives = 43/63 (68.25%), Query Frame = 1 Query: 1 DDIKALLSGGGNPLGADSSGLNSLHYVVWNGHIDCLKLLLANDMGVNEEGKKESCINSQSELG 189 ++++ L+ N D GL +LHY VWNGH++C+KLL+ N GV+ +G+K +C+N +S +G Sbjct: 16 EELEVLVKARANVCSIDEWGLTALHYAVWNGHVECVKLLVFNSHGVDSKGQKTTCLNMKSCIG 78
BLAST of mRNA_H-akashiwo_Contig808.3.1 vs. uniprot
Match: F0YDZ5_AURAN (Uncharacterized protein n=1 Tax=Aureococcus anophagefferens TaxID=44056 RepID=F0YDZ5_AURAN) HSP 1 Score: 61.6 bits (148), Expect = 1.540e-9 Identity = 24/62 (38.71%), Postives = 40/62 (64.52%), Query Frame = 1 Query: 7 IKALLSGGGNPLGADSSGLNSLHYVVWNGHIDCLKLLLANDMGVNEEGKKESCINSQSELGY 192 ++ L+ GGGNP +D +GL LH+ WNGH++C++LL+ ND+GV +E +++ Y Sbjct: 18 LRELILGGGNPCSSDENGLCPLHFATWNGHVECVELLVVNDLGVASAPSEEDLKKLRAKEDY 79 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig808.3.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-akashiwo_Contig808.3.1 >prot_H-akashiwo_Contig808.3.1 ID=prot_H-akashiwo_Contig808.3.1|Name=mRNA_H-akashiwo_Contig808.3.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=64bp DDIKALLSGGGNPLGADSSGLNSLHYVVWNGHIDCLKLLLANDMGVNEEGback to top mRNA from alignment at H-akashiwo_Contig808:253448..253891+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-akashiwo_Contig808.3.1 ID=mRNA_H-akashiwo_Contig808.3.1|Name=mRNA_H-akashiwo_Contig808.3.1|organism=Heterosigma akashiwo CCMP452|type=mRNA|length=444bp|location=Sequence derived from alignment at H-akashiwo_Contig808:253448..253891+ (Heterosigma akashiwo CCMP452)back to top Coding sequence (CDS) from alignment at H-akashiwo_Contig808:253448..253891+ >mRNA_H-akashiwo_Contig808.3.1 ID=mRNA_H-akashiwo_Contig808.3.1|Name=mRNA_H-akashiwo_Contig808.3.1|organism=Heterosigma akashiwo CCMP452|type=CDS|length=192bp|location=Sequence derived from alignment at H-akashiwo_Contig808:253448..253891+ (Heterosigma akashiwo CCMP452)back to top |