mRNA_H-akashiwo_Contig8.114.1 (mRNA) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig8.114.1 vs. uniprot
Match: A0A6S9HN51_HETAK (Hypothetical protein n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A6S9HN51_HETAK) HSP 1 Score: 63.2 bits (152), Expect = 1.380e-9 Identity = 37/49 (75.51%), Postives = 37/49 (75.51%), Query Frame = 3 Query: 3 HGFLPGSRTTALLGAPAWASRGAAAAAAGVAALGAVLVVCARLLFAPYG 149 HG A PAWASRGAAAAAAGVAALGAVLVVCARLLFAPYG Sbjct: 55 HGLYRKPGQPARAAPPAWASRGAAAAAAGVAALGAVLVVCARLLFAPYG 103 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig8.114.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-akashiwo_Contig8.114.1 >prot_H-akashiwo_Contig8.114.1 ID=prot_H-akashiwo_Contig8.114.1|Name=mRNA_H-akashiwo_Contig8.114.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=114bp GTGFYLEAGQPRCWALLLGRRGGRRRRRPGSRLWARSWWSAQGCYLPPTAback to top mRNA from alignment at H-akashiwo_Contig8:5261931..5262570+ Legend: CDSpolypeptideUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-akashiwo_Contig8.114.1 ID=mRNA_H-akashiwo_Contig8.114.1|Name=mRNA_H-akashiwo_Contig8.114.1|organism=Heterosigma akashiwo CCMP452|type=mRNA|length=640bp|location=Sequence derived from alignment at H-akashiwo_Contig8:5261931..5262570+ (Heterosigma akashiwo CCMP452)back to top Coding sequence (CDS) from alignment at H-akashiwo_Contig8:5261931..5262570+ >mRNA_H-akashiwo_Contig8.114.1 ID=mRNA_H-akashiwo_Contig8.114.1|Name=mRNA_H-akashiwo_Contig8.114.1|organism=Heterosigma akashiwo CCMP452|type=CDS|length=342bp|location=Sequence derived from alignment at H-akashiwo_Contig8:5261931..5262570+ (Heterosigma akashiwo CCMP452)back to top |