mRNA_H-akashiwo_Contig1052.6.1 (mRNA) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig1052.6.1 vs. uniprot
Match: A0A6A3EG31_9STRA (SET domain-containing protein n=2 Tax=Phytophthora TaxID=4783 RepID=A0A6A3EG31_9STRA) HSP 1 Score: 47.8 bits (112), Expect = 7.290e-5 Identity = 17/25 (68.00%), Postives = 23/25 (92.00%), Query Frame = 1 Query: 73 NLACERFIQWLQDNGASFPKIQWPS 147 + A +RF+QWLQDNGA+FPK+QWP+ Sbjct: 3 SAAEQRFLQWLQDNGATFPKLQWPT 27 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig1052.6.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-akashiwo_Contig1052.6.1 >prot_H-akashiwo_Contig1052.6.1 ID=prot_H-akashiwo_Contig1052.6.1|Name=mRNA_H-akashiwo_Contig1052.6.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=52bp MSESAEGLGGKISSPQKIDEETSYNLACERFIQWLQDNGASFPKIQWPSKback to top mRNA from alignment at H-akashiwo_Contig1052:147816..148118+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-akashiwo_Contig1052.6.1 ID=mRNA_H-akashiwo_Contig1052.6.1|Name=mRNA_H-akashiwo_Contig1052.6.1|organism=Heterosigma akashiwo CCMP452|type=mRNA|length=303bp|location=Sequence derived from alignment at H-akashiwo_Contig1052:147816..148118+ (Heterosigma akashiwo CCMP452)back to top Coding sequence (CDS) from alignment at H-akashiwo_Contig1052:147816..148118+ >mRNA_H-akashiwo_Contig1052.6.1 ID=mRNA_H-akashiwo_Contig1052.6.1|Name=mRNA_H-akashiwo_Contig1052.6.1|organism=Heterosigma akashiwo CCMP452|type=CDS|length=156bp|location=Sequence derived from alignment at H-akashiwo_Contig1052:147816..148118+ (Heterosigma akashiwo CCMP452)back to top |