mRNA_H-akashiwo_Contig1014.7.1 (mRNA) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig1014.7.1 vs. uniprot
Match: A0A6C0CR77_9ZZZZ (RING-type domain-containing protein n=1 Tax=viral metagenome TaxID=1070528 RepID=A0A6C0CR77_9ZZZZ) HSP 1 Score: 65.9 bits (159), Expect = 8.030e-11 Identity = 28/52 (53.85%), Postives = 39/52 (75.00%), Query Frame = 1 Query: 1 LESLEREVLEGDWGGYYESFRRPLIQRLDTIRETLGEAAPERAEDAFTRPAP 156 L++LE ++L+ DWGGYYE++RRPLI+R+D IR +LG R E FT+P P Sbjct: 36 LDALETDILQRDWGGYYENYRRPLIRRIDEIRASLGCEPKIRDERVFTQPGP 87 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig1014.7.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-akashiwo_Contig1014.7.1 >prot_H-akashiwo_Contig1014.7.1 ID=prot_H-akashiwo_Contig1014.7.1|Name=mRNA_H-akashiwo_Contig1014.7.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=88bp LESLEREVLEGDWGGYYESFRRPLIQRLDTIRETLGEAAPERAEDAFTRPback to top mRNA from alignment at H-akashiwo_Contig1014:346654..347281- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-akashiwo_Contig1014.7.1 ID=mRNA_H-akashiwo_Contig1014.7.1|Name=mRNA_H-akashiwo_Contig1014.7.1|organism=Heterosigma akashiwo CCMP452|type=mRNA|length=628bp|location=Sequence derived from alignment at H-akashiwo_Contig1014:346654..347281- (Heterosigma akashiwo CCMP452)back to top Coding sequence (CDS) from alignment at H-akashiwo_Contig1014:346654..347281- >mRNA_H-akashiwo_Contig1014.7.1 ID=mRNA_H-akashiwo_Contig1014.7.1|Name=mRNA_H-akashiwo_Contig1014.7.1|organism=Heterosigma akashiwo CCMP452|type=CDS|length=264bp|location=Sequence derived from alignment at H-akashiwo_Contig1014:346654..347281- (Heterosigma akashiwo CCMP452)back to top |